KEGG   Bartonella quintana Toulouse: BQ04840Help
Entry
BQ04840           CDS       T00181                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bqu  Bartonella quintana Toulouse
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bqu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BQ04840 (tpiA)
   01230 Biosynthesis of amino acids
    BQ04840 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BQ04840 (tpiA)
   00051 Fructose and mannose metabolism
    BQ04840 (tpiA)
   00562 Inositol phosphate metabolism
    BQ04840 (tpiA)
Enzymes [BR:bqu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     BQ04840 (tpiA)
Exosome [BR:bqu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   BQ04840 (tpiA)
  Exosomal proteins of bladder cancer cells
   BQ04840 (tpiA)
  Exosomal proteins of melanoma cells
   BQ04840 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
591207..591971
Genome map
AA seq 254 aa AA seqDB search
MSPNIRPFIAGNWKMNGTVESLGELRAIAAGVSSDLGHLFEALICVPATLLSRASDALSG
ENLLLGGQNCHFDDCGPYTGDISAFMLKEAGASHVIIGHSERRTVYQESDAIVCAKVQAA
WRAGLVALICVGETLEERTSNKVFNVLTRQLEGSLPDGATAENVIIAYEPVWAIGTGNSP
TSAVVAEVHDFIRHKMCSRFGDDGRKMRLLYGGSVKPSNAFELLSTVHVNGALIGGASLK
AIDFLTICDVYRKL
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgtctccaaatattcgaccttttattgctggaaattggaaaatgaatggaactgttgaa
tctcttggagagttgcgtgctattgctgctggcgttagctctgatttaggccatttgttt
gaagcacttatttgcgttccagcaacgcttttatcgcgtgcttctgatgcacttagtggt
gaaaatcttctcttgggggggcaaaattgtcattttgatgattgtggtccttatactggg
gatatttcagcttttatgcttaaagaagcaggagcaagtcatgtcattattgggcattca
gaacgtcgcacagtttatcaggaaagtgatgcaattgtttgtgctaaagtgcaagcagcg
tggcgggcaggtcttgttgctcttatttgtgttggggaaacattggaagagcgcacaagt
aataaagtgttcaatgtgctcacgcgccagcttgaaggatctttgccagatggcgcaaca
gcagaaaatgtcattattgcttatgaacctgtatgggctataggtactggcaatagcccg
acttcagcagttgttgcagaagtccatgattttattcgtcataagatgtgctctcgtttt
ggtgatgatggaagaaagatgcgtttgctttatggtggatcagtaaaaccatctaatgca
ttcgagcttttgagtactgttcatgtgaatggtgctctgataggtggagcaagtttaaaa
gcgattgattttttaactatttgcgatgtttatcgtaaattataa

DBGET integrated database retrieval system