KEGG   Bartonella quintana Toulouse: BQ04840Help
Entry
BQ04840           CDS       T00181                                 

Gene name
tpiA
Definition
(GenBank) Triose-phosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bqu  Bartonella quintana Toulouse
Pathway
bqu00010  Glycolysis / Gluconeogenesis
bqu00051  Fructose and mannose metabolism
bqu00562  Inositol phosphate metabolism
bqu01100  Metabolic pathways
bqu01110  Biosynthesis of secondary metabolites
bqu01120  Microbial metabolism in diverse environments
bqu01130  Biosynthesis of antibiotics
bqu01200  Carbon metabolism
bqu01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bqu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BQ04840 (tpiA)
   00051 Fructose and mannose metabolism
    BQ04840 (tpiA)
   00562 Inositol phosphate metabolism
    BQ04840 (tpiA)
Enzymes [BR:bqu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     BQ04840 (tpiA)
Exosome [BR:bqu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   BQ04840 (tpiA)
  Exosomal proteins of bladder cancer cells
   BQ04840 (tpiA)
  Exosomal proteins of melanoma cells
   BQ04840 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: CAF25983
UniProt: Q6G029
Position
591207..591971
Genome map
AA seq 254 aa AA seqDB search
MSPNIRPFIAGNWKMNGTVESLGELRAIAAGVSSDLGHLFEALICVPATLLSRASDALSG
ENLLLGGQNCHFDDCGPYTGDISAFMLKEAGASHVIIGHSERRTVYQESDAIVCAKVQAA
WRAGLVALICVGETLEERTSNKVFNVLTRQLEGSLPDGATAENVIIAYEPVWAIGTGNSP
TSAVVAEVHDFIRHKMCSRFGDDGRKMRLLYGGSVKPSNAFELLSTVHVNGALIGGASLK
AIDFLTICDVYRKL
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgtctccaaatattcgaccttttattgctggaaattggaaaatgaatggaactgttgaa
tctcttggagagttgcgtgctattgctgctggcgttagctctgatttaggccatttgttt
gaagcacttatttgcgttccagcaacgcttttatcgcgtgcttctgatgcacttagtggt
gaaaatcttctcttgggggggcaaaattgtcattttgatgattgtggtccttatactggg
gatatttcagcttttatgcttaaagaagcaggagcaagtcatgtcattattgggcattca
gaacgtcgcacagtttatcaggaaagtgatgcaattgtttgtgctaaagtgcaagcagcg
tggcgggcaggtcttgttgctcttatttgtgttggggaaacattggaagagcgcacaagt
aataaagtgttcaatgtgctcacgcgccagcttgaaggatctttgccagatggcgcaaca
gcagaaaatgtcattattgcttatgaacctgtatgggctataggtactggcaatagcccg
acttcagcagttgttgcagaagtccatgattttattcgtcataagatgtgctctcgtttt
ggtgatgatggaagaaagatgcgtttgctttatggtggatcagtaaaaccatctaatgca
ttcgagcttttgagtactgttcatgtgaatggtgctctgataggtggagcaagtttaaaa
gcgattgattttttaactatttgcgatgtttatcgtaaattataa

DBGET integrated database retrieval system