KEGG   Bartonella quintana Toulouse: BQ04930Help
Entry
BQ04930           CDS       T00181                                 

Gene name
pdhC
Definition
(GenBank) Dihydrolipoamide acetyltransferase (E2)
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bqu  Bartonella quintana Toulouse
Pathway
bqu00010  Glycolysis / Gluconeogenesis
bqu00020  Citrate cycle (TCA cycle)
bqu00620  Pyruvate metabolism
bqu01100  Metabolic pathways
bqu01110  Biosynthesis of secondary metabolites
bqu01120  Microbial metabolism in diverse environments
bqu01130  Biosynthesis of antibiotics
bqu01200  Carbon metabolism
Module
bqu_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bqu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BQ04930 (pdhC)
   00020 Citrate cycle (TCA cycle)
    BQ04930 (pdhC)
   00620 Pyruvate metabolism
    BQ04930 (pdhC)
Enzymes [BR:bqu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     BQ04930 (pdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N Pro_CA GCV_H
Motif
Other DBs
NCBI-ProteinID: CAF25992
UniProt: A0A0H3M0B2
Position
600082..601401
Genome map
AA seq 439 aa AA seqDB search
MPIKITMPALSPTMEEGNLLKWNIKEGDKVSYGDVLAEIETDKATMEVEAVDEGTVAKIV
VPAGTQGVRVNSLIVVLAEEGEDLAEAAKVAEKALSSIAVIESKRKKQTDSKSAQMSRLL
SARQVRQQDGRLFASPLARRLAAQEGLDLLCISGSGPHGRIIKRDIDKAMSNDGLEDSCS
LQNKQPVATDSADKKILQLFKEDEYTFILHSNMRKTIAKRLVESKQKVPHFYVTVDCELD
ALLELRTQLNAAAPMVKMQEGFKPAYKLSVNDMVIKTVALSLKAVSDANVSWLEGGILHH
KHCDVGVAVSVSNGLITPIVRHAEEKSLSIISNEMKDFVKRARERKLKMEEYQGGTTAIS
NMGMYGVKSFSAILNPPHATIFAIGAGEKRAVVKNDALGVATIMSVTLSADHRAVDGALA
AELMRTFKKIIENPLAMLI
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgcccattaagattacaatgcctgcgctttcaccaacgatggaagaagggaatttgtta
aaatggaatatcaaagagggggataaggtttcctatggtgatgttcttgctgaaattgag
acagataaggcgacaatggaagtcgaagctgttgatgaaggaacagttgctaagatcgtt
gttcctgctggaacgcaaggcgttagagtgaatagtttaattgttgttttagcagaagaa
ggtgaagacttagctgaagcagcaaaggttgcagaaaaagccctttcctctattgcagtg
atagaatcaaagagaaaaaaacagacagattcaaagtcagcacagatgtctcgtttatta
tcagctcgacaagtaagacagcaagacggacgtctttttgcttcccccttagcgcggcga
ttagcagcgcaagaagggcttgatttattatgtatttctggaagcggtccacatgggcgt
attatcaagcgcgatatagacaaagccatgagcaatgatggtcttgaagattcttgttcg
ttacaaaataaacagccggtagcgacagatagtgctgacaaaaagatacttcaacttttt
aaagaagatgaatatacattcatacttcatagtaatatgcgaaaaacaatcgccaaacgt
ttggtggaatcaaagcaaaaagtaccacatttctatgtgacggtagattgtgaactcgat
gcgttattggagcttcgtacgcaattgaatgctgctgctccaatggttaagatgcaagaa
gggtttaaacccgcttataagctttcagttaacgacatggttattaaaaccgtggcactt
tctttaaaggcggtttctgatgcaaacgtatcttggcttgaaggtggaatacttcatcac
aaacactgtgatgttggggtggctgtttctgtttcgaatggattaattacgccaattgtt
cgccatgcagaggaaaaatctttgtcaattatctctaatgagatgaaagattttgtaaag
cgtgcacgtgagcgcaaattaaaaatggaagagtatcaaggaggaacaacggctatatca
aatatgggcatgtatggagtgaaaagtttttctgctattcttaatccgccacatgcaacg
atttttgcgattggtgcgggtgaaaaacgtgccgttgttaagaatgatgcattaggggtt
gcaacaattatgtcggtcacactttctgctgatcatcgtgctgttgatggtgcattagca
gcggagcttatgcggacctttaagaaaataattgaaaatccattggcaatgttaatttga

DBGET integrated database retrieval system