KEGG   Bartonella quintana Toulouse: BQ05220Help
Entry
BQ05220           CDS       T00181                                 

Definition
lysophospholipase l2
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
bqu  Bartonella quintana Toulouse
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:bqu00564]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(628461..629372)
Genome map
AA seq 303 aa AA seqDB search
MEIPLYPTNWGSPLPDIHNSYLKTAIDRKIRFAITHPKMGKAKGTIVILKSYANALEEYF
LPMNEISNRGFYTTIFDWFDHEGFQPYKRKKTRHNYFDINNDINDLSEFLKNIVYPDCPP
PYYMLTYGIGGLIALSGLDLINHKFNRMLCVSPLFAPFGNKTNSFPHKLTQLLSDIGLGF
LPAKGGKKLKQKNPQFFHTNEAPLSPGFLIKPPTSRWMASVLNAIDRMKKNILNGHLQLP
TLFVLANQNNIANNIEVRQLCQHTHLTDSITITGAELDTIMHEEDYQKQFWAAFDAFIPG
NMP
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
ttggaaatacctctttatcctacaaactggggttcccctcttcccgatatccacaatagc
tatcttaaaacagctattgatcgcaaaattcgttttgcaataacgcatcccaaaatggga
aaagccaagggaacaattgttattctcaaaagctatgcaaatgctttagaagaatatttc
ctaccaatgaatgaaatttctaaccgcggtttttatacaacaatatttgattggtttgat
catgaaggatttcaaccctataaacgaaaaaagactcgacataattattttgatattaat
aatgatattaatgacttaagtgaatttcttaaaaatattgtttatcctgattgtccgcca
ccttactatatgctaacctatggtataggtggattaatagcacttagtggattggatctt
attaaccataaatttaatagaatgctctgcgtttctcccctttttgctccattcggcaat
aaaacaaatagctttccgcataaattaacacagcttctttccgatataggtcttggattc
ttaccagctaaaggtggaaaaaaattaaaacaaaaaaacccacaattttttcacaccaat
gaagcacctttatcccctggtttccttataaaacctcctacatctcgatggatggcatca
gtacttaatgcaattgatagaatgaaaaagaacatccttaatggtcatttacaactccca
acattgtttgttcttgccaatcaaaataatattgccaataacattgaagtgcgccaatta
tgtcaacatacgcatctgacagacagtattacaattacgggggctgaactcgatacaatc
atgcatgaagaagattaccaaaaacaattttgggctgcgtttgatgcatttattcccggt
aacatgccataa

DBGET integrated database retrieval system