KEGG   Bartonella quintana Toulouse: BQ09020Help
Entry
BQ09020           CDS       T00181                                 

Gene name
pncA
Definition
pyrazinamidase/nicotinamidase pnca
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
bqu  Bartonella quintana Toulouse
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bqu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    BQ09020 (pncA)
Enzymes [BR:bqu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     BQ09020 (pncA)
    3.5.1.-  
     BQ09020 (pncA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1062101..1062709
Genome map
AA seq 202 aa AA seqDB search
MEKKALIVIDVQNDFLPGGALAVPQGDTILPVVNNFIDYFDHIILTQDWHPKNHCSFASS
YPEKTPYDTVKLDYGPQILWPDHCIQGTQGAEFHTSLKVEKAQLILRKGYNQKIDSYSAF
FENDQKTPTGLQVYLKEHGFTKLIMCGLATDFCVGFSALHAIQCGFKVSVSLNACAGIDL
NGSLNTMLKTMNEAGIELLITS
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaaaaagccttaatcgttattgacgtccaaaatgacttcttaccaggtggagca
cttgcagtaccacaaggtgatactattttacctgttgttaataatttcatagactatttt
gatcatatcattttaacccaagactggcatcccaaaaaccattgcagctttgcttcttcc
taccctgaaaaaacgccttatgatactgtcaaacttgactatggtcctcaaatactctgg
cctgatcattgtatacaaggaacacaaggagcagaatttcacacatctctcaaagttgag
aaagcacagcttatcctcagaaaaggctataatcaaaaaattgatagctattctgctttt
tttgaaaatgatcaaaaaacaccaacaggcttacaagtttaccttaaagaacatggtttt
acaaaactcattatgtgtggcttagcaacggatttttgtgttggattttctgcacttcat
gccatacaatgcggctttaaagtcagcgtttcattaaatgcctgtgctggtattgattta
aatggatcgcttaatacgatgcttaaaactatgaatgaagccggtatagaactcttaata
acctcctaa

DBGET integrated database retrieval system