KEGG   Bartonella quintana Toulouse: BQ11590Help
Entry
BQ11590           CDS       T00181                                 

Definition
phage related lysozyme
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
bqu  Bartonella quintana Toulouse
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1363748..1364410
Genome map
AA seq 220 aa AA seqDB search
MRKISQEGLALIKQWEGLRLNAYQDAVGLWTIGYGHTSDAGKPSVRKGMKITEKQAAEFL
CQDLQQFENAVEQAVTVPLTDEQFAALVSFCYNVGTTAFCNSMLLKKLNKGDYEAVPVEL
QKWTKAGGKRLQGLVNRRAAEAGLWAKGSYVSSNTQTVEIKVSTGFLKAEALAPIIGSFS
GFGAFLAGNGPVQWALALVMILAACVGIVFVAKRFQEQRL
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgcgaaaaatatcacaagaaggacttgcactgattaaacagtgggaaggattgcgctta
aacgcctatcaagatgctgtcggtctatggacaataggttacggccataccagtgatgct
ggaaaaccttctgttcgcaaaggcatgaagatcacagaaaagcaagctgcagaatttctt
tgtcaagacttgcaacaatttgaaaatgctgttgagcaagctgtcactgttcctttaaca
gatgaacaattcgccgcattagtgtccttttgttataatgtaggaacgacagcattttgc
aattctatgcttttaaaaaagcttaacaagggtgactatgaagcggttccagtcgaatta
cagaaatggaccaaagcaggtgggaaacgtcttcaaggtcttgtcaataggcgtgcagcc
gaagcaggattatgggcaaaagggtcttatgtttcttctaacactcaaacagtggaaata
aaagtatcaacggggtttttaaaagcagaagcccttgcaccaattattggttctttttct
gggtttggagcctttttagccggcaatggtcctgtccaatgggccttagctcttgtgatg
attttagcagcatgtgtcggcattgtctttgttgctaaacgctttcaggagcaacgctta
tga

DBGET integrated database retrieval system