KEGG   Bartonella quintana Toulouse: BQ12710Help
Entry
BQ12710           CDS       T00181                                 

Gene name
sdhD
Definition
(GenBank) Succinate dehydrogenase hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
bqu  Bartonella quintana Toulouse
Pathway
bqu00020  Citrate cycle (TCA cycle)
bqu00190  Oxidative phosphorylation
bqu00650  Butanoate metabolism
bqu01100  Metabolic pathways
bqu01110  Biosynthesis of secondary metabolites
bqu01120  Microbial metabolism in diverse environments
bqu01130  Biosynthesis of antibiotics
bqu01200  Carbon metabolism
Module
bqu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bqu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
bqu_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:bqu00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BQ12710 (sdhD)
   00650 Butanoate metabolism
    BQ12710 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    BQ12710 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS AftA_N Caa3_CtaG
Motif
Other DBs
NCBI-ProteinID: CAF26730
UniProt: A0A0H3M413
Position
complement(1483783..1484169)
Genome map
AA seq 128 aa AA seqDB search
MKKDFQTELGKVRGLGSAREGTEHFWLERLTSVLNLPLCIFFIVLILSLIGKDYTIVHAR
LSHPVVTILMGLLTFSVLYHMKLEMQVVIEDYIRREGLRILFLVLNVSFCFVLGGIIIFA
LLKIALGV
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagattttcaaacagaacttgggaaagtgcgtggacttgggagtgcgcgtgaa
gggacagagcatttttggctagaacgtttgacaagtgtgcttaatctgccactttgtatc
ttttttattgttcttattctctcacttattggaaaggactataccattgtgcatgcacgg
ctttcacatccggttgtaactattttaatgggattgctaactttttcagttctttatcat
atgaaacttgaaatgcaggttgttatcgaagattatattcgacgtgaaggcctgcggata
ctctttttggtattaaatgtttcattttgttttgttctgggcggtataatcatttttgct
cttttaaaaattgcattaggggtttaa

DBGET integrated database retrieval system