KEGG   Bartonella quintana Toulouse: BQ12710Help
Entry
BQ12710           CDS       T00181                                 

Gene name
sdhD
Definition
succinate dehydrogenase hydrophobic membrane anchor protein
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
bqu  Bartonella quintana Toulouse
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:bqu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BQ12710 (sdhD)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BQ12710 (sdhD)
   00650 Butanoate metabolism
    BQ12710 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    BQ12710 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1483783..1484169)
Genome map
AA seq 128 aa AA seqDB search
MKKDFQTELGKVRGLGSAREGTEHFWLERLTSVLNLPLCIFFIVLILSLIGKDYTIVHAR
LSHPVVTILMGLLTFSVLYHMKLEMQVVIEDYIRREGLRILFLVLNVSFCFVLGGIIIFA
LLKIALGV
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagattttcaaacagaacttgggaaagtgcgtggacttgggagtgcgcgtgaa
gggacagagcatttttggctagaacgtttgacaagtgtgcttaatctgccactttgtatc
ttttttattgttcttattctctcacttattggaaaggactataccattgtgcatgcacgg
ctttcacatccggttgtaactattttaatgggattgctaactttttcagttctttatcat
atgaaacttgaaatgcaggttgttatcgaagattatattcgacgtgaaggcctgcggata
ctctttttggtattaaatgtttcattttgttttgttctgggcggtataatcatttttgct
cttttaaaaattgcattaggggtttaa

DBGET integrated database retrieval system