KEGG   Bacillus amyloliquefaciens Y2: MUS_0018Help
Entry
MUS_0018          CDS       T02108                                 

Gene name
dcK
Definition
(GenBank) deoxyadenosine kinase
  KO
K15519  deoxyadenosine/deoxycytidine kinase [EC:2.7.1.76 2.7.1.74]
Organism
bqy  Bacillus amyloliquefaciens Y2
Pathway
bqy00230  Purine metabolism
bqy00240  Pyrimidine metabolism
bqy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bqy00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    MUS_0018 (dcK)
   00240 Pyrimidine metabolism
    MUS_0018 (dcK)
Enzymes [BR:bqy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     MUS_0018 (dcK)
    2.7.1.76  2'-deoxyadenosine kinase
     MUS_0018 (dcK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dNK AAA_18 AAA_28 Thymidylate_kin AAA_33 SKI AAA_15 Cytidylate_kin2 TsaE AAA_22 ABC_tran RsgA_GTPase Cytidylate_kin RNA_helicase AAA AAA_16 MMR_HSR1 AAA_29 GTP_EFTU AAA_25 AAA_14 PRK AAA_5 ParA
Motif
Other DBs
NCBI-ProteinID: AFJ60110
UniProt: I2C0D6
Position
complement(23808..24461)
Genome map
AA seq 217 aa AA seqDB search
MKDIHIPNNAIITVAGTVGVGKSTLTKALAKRLGFHTSLEEVDENPYLEKFYHDFERWSF
HLQIYFLAERFKEQKNMFESGGGFVQDRSIYEDTGIFAKMHADKGTMSLTDYTTYTSLFE
AMVMTPYFPHPDVLIYLEGDLENIINRIEKRGREMELQTNRSYWEEMYTRYEDWISGFNA
CPVLKVRIEDYDLEADEQSLEPLIEKISHVINENRNK
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgaaagacattcatattccaaacaacgccattatcacagtagcgggaacggtaggagtc
ggaaaatcgactttgaccaaagctttagcaaaacggctcgggtttcatacctcactcgag
gaagtggatgaaaatccttatttagagaagttttatcacgattttgaacgctggagcttc
catttgcaaatttattttctggctgagaggttcaaagagcagaaaaatatgtttgaatca
ggcggcggattcgtgcaggaccgttcaatttatgaagatacaggcatattcgcaaaaatg
catgccgataaaggaaccatgtcgctgacagattacacaacatacacaagcctatttgag
gcgatggtcatgacgccgtacttcccgcatcctgatgttttgatctatttagaaggcgac
cttgaaaacattataaaccggattgaaaagcggggccgcgagatggagctgcagacaaac
cgctcctattgggaagagatgtatacgcggtacgaagactggatcagcggttttaacgcc
tgccctgtgctgaaagtacgcattgaagattatgaccttgaagctgatgaacagtcactg
gaacctttgatcgaaaaaatcagtcacgtgatcaacgaaaacagaaacaaataa

DBGET integrated database retrieval system