KEGG   Bacillus amyloliquefaciens Y2: MUS_0018Help
Entry
MUS_0018          CDS       T02108                                 

Gene name
dcK
Definition
deoxyadenosine kinase (EC:2.7.1.76)
Orthology
K15519  
deoxyadenosine/deoxycytidine kinase [EC:2.7.1.76 2.7.1.74]
Organism
bqy  Bacillus amyloliquefaciens Y2
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:bqy00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:bqy00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(23808..24461)
Genome map
AA seq 217 aa AA seqDB search
MKDIHIPNNAIITVAGTVGVGKSTLTKALAKRLGFHTSLEEVDENPYLEKFYHDFERWSF
HLQIYFLAERFKEQKNMFESGGGFVQDRSIYEDTGIFAKMHADKGTMSLTDYTTYTSLFE
AMVMTPYFPHPDVLIYLEGDLENIINRIEKRGREMELQTNRSYWEEMYTRYEDWISGFNA
CPVLKVRIEDYDLEADEQSLEPLIEKISHVINENRNK
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgaaagacattcatattccaaacaacgccattatcacagtagcgggaacggtaggagtc
ggaaaatcgactttgaccaaagctttagcaaaacggctcgggtttcatacctcactcgag
gaagtggatgaaaatccttatttagagaagttttatcacgattttgaacgctggagcttc
catttgcaaatttattttctggctgagaggttcaaagagcagaaaaatatgtttgaatca
ggcggcggattcgtgcaggaccgttcaatttatgaagatacaggcatattcgcaaaaatg
catgccgataaaggaaccatgtcgctgacagattacacaacatacacaagcctatttgag
gcgatggtcatgacgccgtacttcccgcatcctgatgttttgatctatttagaaggcgac
cttgaaaacattataaaccggattgaaaagcggggccgcgagatggagctgcagacaaac
cgctcctattgggaagagatgtatacgcggtacgaagactggatcagcggttttaacgcc
tgccctgtgctgaaagtacgcattgaagattatgaccttgaagctgatgaacagtcactg
gaacctttgatcgaaaaaatcagtcacgtgatcaacgaaaacagaaacaaataa

DBGET integrated database retrieval system