KEGG   Bacillus amyloliquefaciens Y2: MUS_0085Help
Entry
MUS_0085          CDS       T02108                                 

Gene name
sul
Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
bqy  Bacillus amyloliquefaciens Y2
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bqy00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    MUS_0085 (sul)
Enzymes [BR:bqy01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     MUS_0085 (sul)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
86642..87499
Genome map
AA seq 285 aa AA seqDB search
MAQQTIEQPKLIHTKKGALSYKEKTLVMGILNVTPDSFSDGGKYDSTERALLRAVKMAEE
GAHIIDIGGESTRPGASLVSADEEMSRVIPVIERITSELDIPLSIDTYKASVADEAVKAG
ASILNDIWGAKGDPDMASVAAAHGVPIILMHNRMERNYNDLIPDMLADLMESVKIAAEAG
VTDENMILDPGIGFAKNYEDNLAVMNKLEVFSGLGYPLLLATSRKRFIGRVLDLPPEERA
EGTGATVCLGVQKGCDIVRVHDVKEIARMTKMMDAMLNKGGAHYG
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atggcgcagcaaacaattgaacagcctaaactgattcatacaaaaaaaggcgctctgtcc
tataaagagaagacgctcgttatggggatattaaatgtaacgccagactccttctctgac
ggcggcaaatacgacagtacggaaagggcgcttctgcgtgcggtgaagatggctgaagaa
ggggcgcatatcatagatatcggcggtgaatcgacaagacccggcgcatcactcgtgtcg
gctgatgaggaaatgtcacgagtcatccccgtcatagaacggatcacaagcgagctggac
attccgctttcaatcgatacgtacaaagcgtccgtggcagacgaagcggtcaaagcggga
gcctctatccttaatgacatctggggggcgaaaggtgatcctgacatggcgtcagtagcc
gccgcacacggggttccgattatcttaatgcataatcgcatggaaagaaactacaacgat
cttattcctgatatgcttgcagacctgatggaaagcgtgaaaattgccgcagaagccggc
gtcacagatgaaaacatgattctggatccggggatcggctttgcgaaaaactatgaggac
aatctggctgtcatgaacaagctggaggtgttcagcgggttaggttatccgctgctcctg
gcgacatcgagaaaaaggttcatcggccgtgtacttgaccttccccctgaagaacgtgcc
gagggaacgggagcgacagtatgccttggcgtccagaaaggctgcgacattgtgagggtg
cacgatgtcaaagagatcgcaagaatgactaagatgatggatgctatgttgaacaaagga
ggcgcacattatggataa

DBGET integrated database retrieval system