KEGG   Bacillus amyloliquefaciens Y2: MUS_0102Help
Entry
MUS_0102          CDS       T02108                                 

Gene name
gltX
Definition
glutamyl-tRNA synthetase (EC:6.1.1.17)
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
bqy  Bacillus amyloliquefaciens Y2
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Class
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:bqy00970]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
111931..113382
Genome map
AA seq 483 aa AA seqDB search
MGNEVRVRYAPSPTGHLHIGNARTALFNYLFARSQGGKFIIRIEDTDKKRNIEGGEQSQL
NYLKWLGIDWDESVDVGGEYGPYRQSERNDIYKEYYEELLEKGLAYKCFCTEEELEKERE
EQIARGEMPRYSGKHRNLTQEEQEQFLAEGRQPSIRFRVPEGKIIAFNDIVKGEISFESD
GIGDFVIVKKDGTPTYNFAVAIDDYLMKMTHVLRGEDHISNTPKQIMIFQAFGWDVPVFG
HMTLIVNESRKKLSKRDESIIQFIEQYDELGYLPEALFNFIGLLGWSPVGEEELFTREQF
IDIFDVNRLSKSPALFDMHKLKWVNNQYVKALDLDQVVELTLPHLQKAGKVGTELSAEEQ
EWVRKLISLYHEQLSYGAEIVELTDLFFKDEIEYNQEAKAVLEEEQVPEVLSVFAAKLEE
LEEFTPELIKASIKAVQKETGHKGKKLFMPIRVAVTGQTHGPELPQAIELIGRETAVRRL
KSI
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgggaaatgaagtacgcgttcgttatgcaccgagtccgaccggacatttgcatatcggt
aacgccagaacggcgctttttaactatttatttgcccgcagccaaggcggaaagtttatt
atccggattgaggatacggacaaaaagcgaaatattgaaggcggagagcaaagtcagctc
aactatttgaaatggctcggcatagactgggatgaaagtgtggatgtcggcggagaatac
ggcccgtaccgccagtctgagcgtaacgacatttacaaagagtactatgaagagcttctt
gaaaaagggctagcttataaatgtttctgtacggaagaagaacttgagaaagaacgtgaa
gagcaaatcgcccgcggggaaatgccgcgctattccggcaaacacagaaacctgactcag
gaagagcaggagcagtttttagccgaaggcagacagccgagcatccgtttccgcgtgccg
gaagggaaaatcatcgcatttaacgatatcgtaaaaggtgagatttcttttgaatcagac
ggcatcggcgactttgtcatcgtcaaaaaagacggaacaccgacgtataactttgccgtc
gcgattgacgattacttaatgaaaatgacgcacgtgctccgcggtgaggatcacatttca
aatacaccgaaacagatcatgattttccaggcattcggctgggatgttcctgtcttcgga
catatgacgcttatcgtaaacgaaagccgcaaaaaattaagtaaacgtgatgaatcaatt
atccagtttattgagcagtatgatgagctgggttacctgcctgaagcgctgtttaacttt
atcggacttctcggctggtctcccgtcggtgaagaagagcttttcacaagagaacaattc
attgacatttttgatgtaaatcgtttgtctaagtcaccggctctgtttgatatgcataaa
ctgaaatgggtcaacaaccaatacgtcaaagcgctggatcttgatcaagttgttgagctg
accctgccgcacctgcaaaaagcaggaaaagtcggcactgagctttctgccgaagagcag
gaatgggttcgtaaattaatctctctttaccatgagcaattgagctacggcgctgaaatt
gtcgagctgactgatttgttctttaaagatgagatcgagtataatcaagaggcaaaagcc
gttctggaagaagaacaggtgcctgaagtgctcagcgtatttgctgcgaagcttgaagag
cttgaagaatttacgcctgagctgatcaaagcctcaatcaaggctgttcagaaagaaaca
ggccataaaggcaaaaagctgttcatgccgattcgtgtagcggttaccggtcagacacac
ggtccggagcttccgcaggccattgagctgatcggcagagaaacagccgtaagacgcctg
aaaagcatttaa

DBGET integrated database retrieval system