KEGG   Bacillus amyloliquefaciens Y2: MUS_0102Help
Entry
MUS_0102          CDS       T02108                                 

Gene name
gltX
Definition
glutamyl-tRNA synthetase (EC:6.1.1.17)
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
bqy  Bacillus amyloliquefaciens Y2
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bqy00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    MUS_0102 (gltX)
Enzymes [BR:bqy01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.24  glutamate---tRNAGln ligase
     MUS_0102 (gltX)
Amino acid related enzymes [BR:bqy01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   MUS_0102 (gltX)
Transfer RNA biogenesis [BR:bqy03016]
 Prokaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    MUS_0102 (gltX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
111931..113382
Genome map
AA seq 483 aa AA seqDB search
MGNEVRVRYAPSPTGHLHIGNARTALFNYLFARSQGGKFIIRIEDTDKKRNIEGGEQSQL
NYLKWLGIDWDESVDVGGEYGPYRQSERNDIYKEYYEELLEKGLAYKCFCTEEELEKERE
EQIARGEMPRYSGKHRNLTQEEQEQFLAEGRQPSIRFRVPEGKIIAFNDIVKGEISFESD
GIGDFVIVKKDGTPTYNFAVAIDDYLMKMTHVLRGEDHISNTPKQIMIFQAFGWDVPVFG
HMTLIVNESRKKLSKRDESIIQFIEQYDELGYLPEALFNFIGLLGWSPVGEEELFTREQF
IDIFDVNRLSKSPALFDMHKLKWVNNQYVKALDLDQVVELTLPHLQKAGKVGTELSAEEQ
EWVRKLISLYHEQLSYGAEIVELTDLFFKDEIEYNQEAKAVLEEEQVPEVLSVFAAKLEE
LEEFTPELIKASIKAVQKETGHKGKKLFMPIRVAVTGQTHGPELPQAIELIGRETAVRRL
KSI
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgggaaatgaagtacgcgttcgttatgcaccgagtccgaccggacatttgcatatcggt
aacgccagaacggcgctttttaactatttatttgcccgcagccaaggcggaaagtttatt
atccggattgaggatacggacaaaaagcgaaatattgaaggcggagagcaaagtcagctc
aactatttgaaatggctcggcatagactgggatgaaagtgtggatgtcggcggagaatac
ggcccgtaccgccagtctgagcgtaacgacatttacaaagagtactatgaagagcttctt
gaaaaagggctagcttataaatgtttctgtacggaagaagaacttgagaaagaacgtgaa
gagcaaatcgcccgcggggaaatgccgcgctattccggcaaacacagaaacctgactcag
gaagagcaggagcagtttttagccgaaggcagacagccgagcatccgtttccgcgtgccg
gaagggaaaatcatcgcatttaacgatatcgtaaaaggtgagatttcttttgaatcagac
ggcatcggcgactttgtcatcgtcaaaaaagacggaacaccgacgtataactttgccgtc
gcgattgacgattacttaatgaaaatgacgcacgtgctccgcggtgaggatcacatttca
aatacaccgaaacagatcatgattttccaggcattcggctgggatgttcctgtcttcgga
catatgacgcttatcgtaaacgaaagccgcaaaaaattaagtaaacgtgatgaatcaatt
atccagtttattgagcagtatgatgagctgggttacctgcctgaagcgctgtttaacttt
atcggacttctcggctggtctcccgtcggtgaagaagagcttttcacaagagaacaattc
attgacatttttgatgtaaatcgtttgtctaagtcaccggctctgtttgatatgcataaa
ctgaaatgggtcaacaaccaatacgtcaaagcgctggatcttgatcaagttgttgagctg
accctgccgcacctgcaaaaagcaggaaaagtcggcactgagctttctgccgaagagcag
gaatgggttcgtaaattaatctctctttaccatgagcaattgagctacggcgctgaaatt
gtcgagctgactgatttgttctttaaagatgagatcgagtataatcaagaggcaaaagcc
gttctggaagaagaacaggtgcctgaagtgctcagcgtatttgctgcgaagcttgaagag
cttgaagaatttacgcctgagctgatcaaagcctcaatcaaggctgttcagaaagaaaca
ggccataaaggcaaaaagctgttcatgccgattcgtgtagcggttaccggtcagacacac
ggtccggagcttccgcaggccattgagctgatcggcagagaaacagccgtaagacgcctg
aaaagcatttaa

DBGET integrated database retrieval system