KEGG   Bacillus amyloliquefaciens Y2: MUS_0248Help
Entry
MUS_0248          CDS       T02108                                 

Gene name
phoD
Definition
phosphodiesterase/alkaline phosphatase D (EC:3.1.4.1)
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
bqy  Bacillus amyloliquefaciens Y2
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:bqy00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:bqy00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:bqy02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
260138..261889
Genome map
AA seq 583 aa AA seqDB search
MTHDGRLDEWIKELENKSFQNNTFDRRAFIQGAGKIAGLSLGLAIAQSIGAFEVNAAPKF
SNYPFTLGVASGDPLSDSVILWTRLAPDPLNGGGMPKQAVPVKWEIATDEHFRHIVKRGT
EMAKPNLGHSVHVEADGLKPNKVYYYRFKSGHELSPVGRTKTLPAPGADVSAMTFAFASC
QQYEHGYYTAYKHMAKEKLDLVFHLGDYIYEYGPNEYVSKTGNVRTHSSAEVYTLSDYRN
RHAQYRSDANLKAAHAAFPWVVTWDDHEVENNYANVIPEKGQSVEAFVLRRAAAYQAYYE
HMPLRRMSLPNGPDMRLYRQFSYGNLASFNVLDTRQYRDDQANGDGNKPPSDEWRDPKRT
LMGTEQEQWLFGNLAASKAKWNVLAQQIFFAQWNFGTTANPIYSMDSWDGYPAQRERVIN
FIKSKNLNNVIVLTGDVHASWASNLHTDFNQTNSKIFGAEFVGTSITSGGNGADKRADTD
QILKQNPHIKFFNDYRGYVRCTVTPAQWRADYRVVPYVTEPGAEVSTRASFIYQKDQTGI
RKVSQAAVAGGLKQSNEVEEDRFFAHNNAHEKQMRKKRAKISQ
NT seq 1752 nt NT seq  +upstreamnt  +downstreamnt
atgacacatgacggccgtttagatgaatggatcaaggaattggagaacaaaagctttcag
aacaatacgtttgaccgccgcgcatttatacaaggcgccgggaaaatcgccggtctttcc
ctcgggttagcgatcgcgcaatccatcggcgcgtttgaagtgaatgccgctccgaaattt
tcaaactatccgttcaccctcggcgtagcctccggcgacccgctgtctgacagcgtcatt
ctctggacgcgtcttgccccggacccgctgaatgggggcggcatgccgaagcaggccgtg
ccggtaaaatgggaaatcgctactgatgaacatttccgtcacatcgtcaaacgcggaacg
gaaatggccaagccgaatctcggacactccgtccatgtcgaggcggacgggctcaagccc
aataaagtgtactattaccggtttaaaagcgggcatgagctcagtcccgtcggccggacg
aaaacgctgcccgctcccggcgctgacgtatccgccatgacgtttgcgtttgcctcatgc
cagcagtatgaacacggctattatacggcgtataaacatatggcgaaggaaaagcttgat
ctcgtgttccatctcggagattacatttatgaatacggaccgaacgaatatgtgtcaaaa
acgggaaatgtcaggacgcacagcagcgctgaagtgtatacactgtcagattaccgcaac
cgtcatgcccaataccgctctgatgccaatctgaaagccgcccacgccgcatttccgtgg
gtcgtgacgtgggacgatcatgaggtggaaaacaattatgccaatgttatccctgaaaaa
ggccaatccgttgaagcgtttgtgctcaggagggccgcagcttatcaggcttattatgaa
cacatgccgctcaggcgcatgtcattgccgaacggtcctgatatgcggctgtacaggcaa
ttttcttatggcaatttggcatcgttcaatgtgcttgatacaagacagtatagagatgat
caggccaacggcgacgggaataagccgccttctgatgagtggagagacccgaagcgtaca
ttgatggggacagaacaggagcaatggctcttcggaaatttagccgcctcaaaagcgaag
tggaatgtgctggcgcagcaaatctttttcgcgcaatggaatttcggaacaaccgccaat
ccgatatacagcatggattcatgggacggctatccggcgcagcgggagcgggtcatcaat
tttataaaaagcaaaaacctgaacaatgtcatcgtgctgacaggtgatgttcacgcaagc
tgggcgtcaaacctgcataccgattttaaccaaacgaattcaaagattttcggagccgaa
ttcgtcgggacctccattacatctggaggaaacggggcggataaacgggccgatacggat
cagatcttaaaacaaaacccgcatattaagtttttcaacgattaccgaggctatgtccgc
tgtacggtgacccctgcccaatggagagcggattacagagtggtgccgtacgtgacggag
ccgggggctgaggtatccacgcgggcttcattcatttatcagaaagaccagacggggatt
cggaaggtctctcaagctgcggttgcaggcggtttaaagcagtcaaacgaggtggaagag
gatcgtttcttcgcccataacaatgcgcatgaaaagcaaatgagaaagaaacgggccaaa
atctcacaataa

DBGET integrated database retrieval system