KEGG   Bacillus amyloliquefaciens Y2: MUS_0320Help
Entry
MUS_0320          CDS       T02108                                 

Gene name
yckE
Definition
beta-glucosidase (EC:3.2.1.21)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
bqy  Bacillus amyloliquefaciens Y2
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:bqy00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MUS_0320 (yckE)
Enzymes [BR:bqy01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     MUS_0320 (yckE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
333963..335408
Genome map
AA seq 481 aa AA seqDB search
MKHMIHKKQGLFPDTFLWGSASAAYQVEGAWNKDGKGPSVWDLFTKIPGKTFKGSNGDTA
VGHYERYKEDIALMAEMGLKAYRFSVSWPRIFPNGRGEINESGIAFYEDLIDELISNDIE
PVLTLYHWDLPQALMDEYGGFESRKIIDDFNDYCIALYKRFAGKVKYWVTLNEQNYNFHN
GFITAAHPPGVKDRKRFYAANHIAFLANAKAIESFRQYVPDGLIGPSFAYSPAYPLTSHP
EDITAFENAEEFMNHWWLDMYCRGTYPQIPFNYLKEKGWAPAIEAGDMELLAKGKPDFIG
VNYYQTITYERNPLDGVSEGKMNTTGQKGTNQDTGIPGLFKTKKNPNLVTSNWDWTIDPI
GLRIGLRRITSRYELPVFITENGLGEFDKIEEDGSIQDDYRIDYLRSHLEQCREAISDGV
HLIGYCSWSFTDLLSWLNGYQKRYGFVYINRDEEDEKDLKRIRKKSFYWYQNVIETNGKS
L
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgaaacacatgatacataaaaaacagggcctgttccctgatacatttctatgggggtca
gcctcggctgcctatcaggttgaaggagcctggaataaagacggtaaaggaccttcagta
tgggacttattcacgaaaataccgggtaaaacgtttaaaggctcaaatggcgatacagca
gtcggccattatgagcgctataaagaagatatcgccttgatggcagaaatgggtttgaaa
gcttaccgattttctgtcagctggccgagaatttttccgaatggcagaggggaaattaac
gaatcagggatcgcattttacgaagacctgatcgatgaattgatttctaacgatattgag
ccggtgctgactctttatcattgggacttgcctcaggcgctgatggatgaatacggcggc
tttgaatcaagaaaaattattgatgattttaatgattactgcattgcgttatacaaaaga
tttgccggcaaggtgaaatactgggtcacgttaaatgagcagaattataattttcataac
gggtttataacagctgcacatccgcccggcgtaaaggacagaaaacgattttatgcagcg
aatcatatcgcatttttagctaatgccaaagcgattgaatccttcagacaatatgttcct
gacggtttgatcggcccgagcttcgcttattcaccggcttatccgcttacaagtcaccct
gaagacataactgcatttgaaaacgcagaggaatttatgaaccattggtggcttgatatg
tattgccgggggacttatccgcaaattcctttcaattatttaaaggaaaagggctgggcg
cccgccattgaagccggggatatggaattgcttgcgaaaggcaagccggattttatcggt
gttaattattatcagacgattacgtacgaaagaaatcctcttgatggtgtatcggagggg
aaaatgaacacgactggtcagaaagggacaaaccaggataccggtataccggggctgttt
aaaacgaaaaagaatcctaacctcgtgacgagtaattgggattggacgattgacccgata
ggtctgcgcatcggccttcggcgtataacgagccgctatgagctgccggtttttataaca
gaaaacgggctgggggaattcgataaaatagaagaagacggctcaattcaggatgactac
agaattgactatttacgctcccatcttgaacagtgcagagaggccattagtgatggagtt
catctcatcggctactgcagctggtcattcacggatctgttaagctggctgaacggctat
caaaaacgctacggttttgtctatatcaatcgagatgaagaagatgaaaaagatttgaaa
cggatcaggaaaaaaagtttttattggtatcagaatgtaattgaaacaaacggtaaaagt
ttataa

DBGET integrated database retrieval system