KEGG   Bacillus amyloliquefaciens Y2: MUS_0726Help
Entry
MUS_0726          CDS       T02108                                 

Gene name
yetO
Definition
NADPH-ferrihemoprotein reductase, unspecific monooxygenase (EC:1.14.14.1 1.6.2.4)
Orthology
K14338  
cytochrome P450 / NADPH-cytochrome P450 reductase [EC:1.14.14.1 1.6.2.4]
Organism
bqy  Bacillus amyloliquefaciens Y2
Pathway
Fatty acid degradation
Tryptophan metabolism
Aminobenzoate degradation
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bqy00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    MUS_0726 (yetO)
  Amino acid metabolism
   00380 Tryptophan metabolism
    MUS_0726 (yetO)
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    MUS_0726 (yetO)
Enzymes [BR:bqy01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     MUS_0726 (yetO)
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     MUS_0726 (yetO)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
703135..706338
Genome map
AA seq 1067 aa AA seqDB search
MLERVLFMKETGPIPQPKTFGPLGNLPLLDKDKPTMSLIKLANEQGPIFQLHTPAGAIIV
VSGHELVKEVCDEERFDKSIEGALEKVRAFSGDGLFTSWTHEPNWRKAHNILMPTFSQRA
MKDYHSMMTDIAVQLIQKWARLNPDEAVDVPADMTRLTLDTIGLCGFNYRFNSYYRETPH
PFINSMVRALDEAMHQMQRLDVQDKLMIRTKRQFHHDIQAMFSLVDSIIAERRSGGRDEK
DLLARMLNVEDPETGEKLDDENIRFQIITFLIAGHETTSGLLSFAIYFLLKHPRVLEKAY
EEADRVLTDPVPSYKQVLDLTYIRMILQESLRLWPTAPAFSLYAKEDTVIGGKYPITPKD
RISVLIPQLHRDKDAWGDNAEEFYPERFEHPDQVPHHAYKPFGNGQRACIGMQFALHEAT
LVLGMILQHFTFIDHTDYELDIKQTLTIKPGDFHIRVRPRNKGAVAAALPAAEKAAEDVE
KEKRETKGASIIGLDNRPLLILYGSDTGTAEGVARELADTAGMHGVRTETAPLNDRIGKL
PKEGALLIITSSYNGKPPSNAGQFVQWLEEVKPGELEGVRYAVFGCGDHNWAATYQAVPR
LIDEKLAEKGAERFSSRGEGDVSGDFEGKLDEWKKSMWTDAMKAFGLKLNENAEKERSSL
GLQFVSGLGGSPLAQTYEAVYASVAENRELQAPESGRSTRHIEITLPKEAAYHEGDHLGV
LPVNSKEQVSRVLRRFNLNGNDQVLLTASGQSAAHLPLDRPVRLHDLLSSCVELQEAASR
AQIREMAAYTVCPPHKRELEDFLEEGVYQEKILTLRVSMLDLLEKYEACELPFERFLELL
RPLKPRYYSISSSPRKHPGQASITVGVVRGPARSGLGEYRGVASNYLADRGPEDGIVMFV
RTPETRFRLPEDPEKPIIMVGPGTGVAPFRGFLQARAALKKEGKELGEAHLYFGCRNDHD
FIYRDELEAYEKDGIVTLHTAFSRKEGVPKTYVQHLMAKDAGALISILGRGGHLYVCGDG
SKMAPDVEATLQKAYQSVHETDERQAQEWLLDLQTKGIYAKDVWAGI
NT seq 3204 nt NT seq  +upstreamnt  +downstreamnt
gtgttagaaagggtgttattcatgaaggaaacaggtccgattccgcagccgaagacattc
ggcccgctcggcaatcttcctttgcttgataaagacaagcctacaatgtcgcttatcaaa
ctggcaaacgagcaggggcctatttttcagctgcatacgccggcgggcgccattatcgtc
gtgtccggccatgaactggtgaaagaggtttgtgatgaagagcggttcgataaaagcatt
gaaggggctttagagaaagtccgggcgttttccggtgacgggctgtttacaagctggacg
catgagcctaactggcgaaaggcgcataatattctgatgccgaccttcagccagcgcgcg
atgaaagattatcattcgatgatgactgatatcgcggtgcagctgattcaaaaatgggct
aggctgaacccggatgaggccgttgatgtgcctgctgatatgacccgcctgacgctcgat
acgatcgggctttgcggctttaactatcggtttaacagctattacagggaaacgcctcat
ccgtttatcaacagcatggtgcgcgcccttgatgaagcgatgcaccaaatgcagcgcctt
gatgttcaggataagctcatgatcaggacgaagcgccaatttcatcatgacattcaggcg
atgttttcgttagtagacagtattatcgcagagcgccggtcaggcggccgggatgaaaag
gatctgctggccagaatgctgaatgtggaagacccggaaacgggcgaaaaacttgatgat
gaaaatatccggtttcaaatcattacgtttttaattgccggccatgaaacgaccagcggc
ctgctttcctttgccatctattttctgctgaaacatccccgtgttttggaaaaagcctat
gaggaagccgatcgggtattgaccgatcccgttccttcatataaacaagtgctggatctt
acttatatccgaatgattttgcaggagtcattgcgcttatggccgaccgcgcctgcgttc
agcctttatgcgaaagaggatacggtgatcggcgggaaatatccgatcacgccgaaagac
agaatttccgtcttaattccccagcttcaccgtgataaagacgcgtggggagacaatgcg
gaggaattttatccggagcggtttgaacatcctgatcaagtgcctcaccatgcgtacaag
ccgttcggaaacggtcagagggcatgtatcggtatgcagttcgccctgcatgaagcaacc
cttgttctggggatgattctgcagcattttacctttatcgatcacaccgattatgagctc
gatattaaacagacactaacgatcaagcccggcgactttcatatccgggtgcggccgaga
aacaaaggagccgttgcggcagctctcccggcggctgaaaaagcggcggaagacgtcgaa
aaagaaaaacgggaaacaaaaggcgcatccattatcgggcttgataaccgaccgcttctg
attctgtacggctcagatacgggaaccgcagaaggcgtggcgcgggagcttgccgatact
gccgggatgcacggcgtccggactgaaacggcgcctttaaatgaccggatcggaaaactg
ccgaaagaaggagctctcttgatcattacgtcctcttataacggaaagcctccgagcaac
gcgggacaattcgttcaatggcttgaagaagtcaaacccggggagctggaaggtgtccga
tatgccgtcttcggctgcggtgatcataactgggcggcgacatatcaggccgtgccgagg
cttattgatgagaagcttgccgaaaaaggggcggaacgcttttcctcccgaggcgaaggg
gacgtcagcggcgattttgaaggaaagcttgatgaatggaaaaaaagcatgtggacggac
gccatgaaggcattcggtctcaagctgaatgaaaatgccgaaaaagagcgaagttcgctg
ggccttcaatttgtcagcgggcttggcgggtcccctttggcacagacgtatgaagcggtt
tacgcatccgttgcggaaaacagggaacttcaggcgccggaaagcggccggagcacaagg
catatcgaaatcactctgccgaaagaggctgcctatcatgaaggggatcatctcggcgtg
ctgccggtaaacagcaaagagcaggtcagccgtgttctccgccggttcaatctgaacggg
aatgatcaagtgctgctgacggccagcggacagagcgcggctcatctcccgctcgatcgg
ccggtcaggctgcatgatcttctgagcagctgtgtcgaattgcaggaagcggcatcaagg
gctcaaatccgggaaatggccgcttatacggtctgcccgccgcacaaacgggaattggaa
gattttcttgaggagggcgtctatcaggagaaaatcttaacattgcgcgtctcgatgctc
gatctccttgaaaaatatgaagcgtgtgaacttccgtttgagcgatttctggagcttttg
cgcccgctgaagccgcggtattattcgatttcaagttcgccgcggaaacatcccgggcag
gcctcaattaccgtcggcgtcgttcgcggccccgcccggagcggtttgggtgagtatcgg
ggagtcgcttcgaattatttagcggaccgcggccctgaggatggtatcgtgatgtttgtc
cgcactccggaaacacgattccggctgccggaagatccggaaaaaccgattattatggtc
ggtcccggcacaggagtcgccccgttccgcggatttctgcaggcccgggcggcgttaaaa
aaagaaggaaaagagctgggggaggctcatctgtatttcggatgcagaaacgatcatgat
tttatttaccgtgacgagcttgaagcttatgaaaaagacggaatcgtgacgcttcatacg
gctttctcccgcaaagaaggcgtaccgaaaacgtatgtgcagcacttaatggcgaaagac
gccggcgctttaatttccatcctcggccggggagggcacctctacgtatgcggcgacggc
agcaaaatggcgcccgatgtagaggcaacgctgcaaaaagcgtatcagtcggtccacgaa
acagacgaacggcaagcgcaagaatggcttttggacctccagacaaaaggcatttacgca
aaagatgtttgggcggggatttga

DBGET integrated database retrieval system