KEGG   Bacillus amyloliquefaciens Y2: MUS_0967Help
Entry
MUS_0967          CDS       T02108                                 

Gene name
glpK
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
bqy  Bacillus amyloliquefaciens Y2
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:bqy00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
919785..921275
Genome map
AA seq 496 aa AA seqDB search
METYILSIDQGTTSSRAILFNKEGKIVHSAQKEFTQHFPQPGWVEHNANEIWGSVLAVIA
TVISESGISADQIAGIGITNQRETTVVWDKDTGKPVYNAIVWQSRQTSGICEELREKGYN
DTFREKTGLLIDPYFSGTKVKWILDNVEGAREKAENGNLLFGTIDSWLIWKMSGGAAHVT
DYSNASRTLMFNIHELKWDDELLDILGVPKSMLPEVKPSSHVYAKTVDYHFFGKNIPIAG
AAGDQQSALFGQACFEEGMGKNTYGTGCFMLMNTGEKAITSDHGLLTTIAWGLDGKVEYA
LEGSIFVAGSAIQWLRDGMRMFQDSKESETYAERVDSADGVYVVPAFVGLGTPYWDSDVR
GSVFGLTRGTTKEHFIRATLESLAYQAKDVLDAMEADSGISLKTLRVDGGAVKNNFLMQF
QSDLLDVPVERPEINETTALGAAYLAGIAVGYWKDSTEIADQWNLDKQFKPEMEDEKREE
LYGGWKKAVNAAMAFK
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atggagacctatattttatcaattgaccaaggcacaacaagttcaagagcgattcttttt
aataaagaaggaaaaatcgtgcattccgctcaaaaggaattcacacagcatttccctcag
ccgggctgggtggagcacaatgcgaacgaaatctggggatcggtgctcgccgttatcgcg
actgtgatctccgagtccggaatcagcgctgatcaaattgccggcatcggcatcacgaac
caaagggaaacgacggtcgtatgggataaagataccggaaagccggtatacaatgcgatt
gtgtggcaatcgagacaaacatccggcatttgcgaagagcttcgtgaaaaaggatataat
gatacattcagagaaaaaacgggacttttgatcgacccttatttctcaggaacgaaagtc
aaatggattcttgacaatgtagaaggcgcgcgggaaaaagcggaaaacggaaatcttctg
ttcggaacgattgattcatggctcatctggaaaatgtccggaggggcggcgcacgtaacg
gattattccaacgcttcaagaacgctgatgtttaatattcatgaattaaaatgggatgac
gagctgcttgatattttaggcgtgccgaaatcaatgctgccggaagtgaaaccgtcttct
catgtgtacgcgaaaacggttgattatcatttcttcggtaaaaacattccgattgcggga
gcggcgggagaccagcagtcagcgctgttcggccaggcgtgctttgaagaaggcatgggg
aaaaacacatacggcacaggctgctttatgctgatgaataccggagaaaaagccatcact
tctgatcacggccttctgacgacaatcgcctggggattagacggaaaagtcgagtatgca
ctggaaggaagcatctttgtcgcaggttctgccatccaatggctgagagacggcatgcgg
atgttccaggattcaaaagaaagcgagacatacgcagagcgcgtggattccgctgacggt
gtttatgtcgtgcccgctttcgtcggattaggcacaccgtactgggacagtgacgtgcgc
ggctcagttttcggcctgacacgcggaacgacgaaggagcatttcatccgggctacgctt
gaatctctcgcttatcaggcgaaagatgtgcttgatgccatggaggctgattcaggcatc
tctttaaaaacattgcgtgtagacggcggagcggtaaaaaataacttcctcatgcagttc
caaagcgacttgcttgatgtgccggtcgaacgtccggaaattaatgaaacgacggcgctc
ggtgccgcgtatttggccggaatcgctgtcggatactggaaggacagcactgaaatcgcc
gatcagtggaaccttgataagcaattcaaaccggaaatggaagatgaaaagcgcgaagaa
ttgtacggcggatggaaaaaagcagtaaatgcagctatggcttttaaataa

DBGET integrated database retrieval system