KEGG   Bacillus amyloliquefaciens Y2: MUS_1443Help
Entry
MUS_1443          CDS       T02108                                 

Gene name
mtnD
Definition
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase (EC:1.13.-.-)
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
bqy  Bacillus amyloliquefaciens Y2
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Module
Methionine salvage pathway
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:bqy00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1325849..1326385
Genome map
AA seq 178 aa AA seqDB search
MATIRIHDEKNTIIEHQEEVARFLDEQEVIYEQWNIEKLPSELSEKYDLTEDEKERILAA
FDTEIQDISARRGYQSQDVIYLSDTTPNLDELLKNFQREHHHTDDEVRFIVSGHGIFVIQ
GKDGTFFDVRLNPGDLISVPENIRHYFTLQEDRRVVAIRIFVTTEGWVPIYENESVQN
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
atggcgaccatcagaattcatgacgaaaaaaatacgatcattgaacatcaggaagaagta
gcgcgcttcttagatgaacaagaggtgatctatgagcagtggaacattgaaaaacttccg
tctgagctttcggaaaaatacgatctaactgaagatgaaaaagaacggattctcgcggcg
tttgacacggagattcaggacatttcagcccggcgcggatatcagtctcaggatgtcatt
tatttatcagataccacgccgaatcttgatgaattattaaaaaatttccaaagagaacat
caccacacggatgatgaagtccgctttatcgtcagcggacacggcatcttcgtcattcaa
ggcaaagacggcacatttttcgacgtccgtttaaatccgggagatttgatttcagttccg
gagaacatccgccactactttacgcttcaggaagaccgccgggtcgtcgcaatccggatc
tttgtgacgactgagggctgggtgccgatttacgaaaatgaaagtgtgcaaaactga

DBGET integrated database retrieval system