KEGG   Bacillus amyloliquefaciens Y2: MUS_1629Help
Entry
MUS_1629          CDS       T02108                                 

Gene name
ylaM1
Definition
glutaminase (EC:3.5.1.2)
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
bqy  Bacillus amyloliquefaciens Y2
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bqy00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    MUS_1629 (ylaM1)
   00330 Arginine and proline metabolism
    MUS_1629 (ylaM1)
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    MUS_1629 (ylaM1)
Enzymes [BR:bqy01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     MUS_1629 (ylaM1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1531469..1532137
Genome map
AA seq 222 aa AA seqDB search
MFIPLTGDPFNSMIKLETVNPGKPLNPMINAGALVVTGLIKGHSPKDRLNYLLGFIRRLA
NNQDITYCSHVAESEFKSSMINRAMCYYMKQYDIFKGDVEEVMDLYTKQCAIKMSSLDLA
KIGCVFALDGKHPETGEQVIKKDVARICKTFMVTCGMYNASGEFAIKVGIPAKSGVSGGI
MGISPYNFGIGIFGPALDEKGNSIAGVKLLEIMSEKYRLSIF
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgttcattccattaaccggcgacccgtttaattccatgattaagcttgaaacagtaaat
ccgggcaagcctttaaatccgatgattaatgcgggagctctcgtcgttacgggtttaatt
aaagggcattcgccgaaagaccgcctgaattacctgctcggattcatcagaagacttgcg
aataatcaggacattacatattgcagccatgtcgcggaatcggaattcaaatcttccatg
attaatcgggccatgtgttattacatgaagcagtatgacatttttaaaggcgatgttgaa
gaggtcatggatttgtatacaaaacagtgcgcgattaagatgagcagtctggatttagcc
aaaatcggctgtgtattcgcccttgacggcaagcatccggaaaccggggagcaggtcatt
aaaaaagatgtggcgagaatctgcaagacgtttatggtgacctgcggcatgtacaatgcg
agcggggaattcgcaatcaaggtcggcattcccgctaaaagcggcgtttcgggaggaatc
atgggtatttcgccgtacaacttcggaatcggtatattcggcccggcgcttgatgaaaaa
ggcaacagcatcgcgggtgtgaagcttttggaaatcatgtctgagaaatacaggctgagt
attttttga

DBGET integrated database retrieval system