KEGG   Bacillus amyloliquefaciens Y2: MUS_1698Help
Entry
MUS_1698          CDS       T02108                                 

Gene name
pyrB
Definition
(GenBank) aspartate carbamoyltransferase
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
bqy  Bacillus amyloliquefaciens Y2
Pathway
bqy00240  Pyrimidine metabolism
bqy00250  Alanine, aspartate and glutamate metabolism
bqy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bqy00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    MUS_1698 (pyrB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    MUS_1698 (pyrB)
Enzymes [BR:bqy01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     MUS_1698 (pyrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: AFJ61697
UniProt: I2C4X3
Position
1598286..1599200
Genome map
AA seq 304 aa AA seqDB search
MNHLTAMSELSTAEITELLREAKAIKEGTVRPDLAGKFVANLFFEPSTRTRFSFEVAEKK
LGMNVLSLDDTSTSVQKGESLYDTVKTLESIGADACVIRHSTDEYYKDLTGRVNIPILNA
GDGCGQHPTQSLLDLMTIQEEFETFQGLTVSIHGDIKHSRVARSNAEVLTRLGARVLFSG
PPQWQDEKNAFGTCVQTDEAIQASDVVMLLRIQNERHQTEADQKGYLEAYGLTAKRAESM
KRHAIIMHPAPVNRGVEIDTTLVECGKSRIFKQMENGVYIRMAVLKRALQTNVKRGEAAY
VLSH
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgaatcatttaacggcgatgtctgaactgagcacggctgaaattacagaactgctgcgt
gaggcaaaagcgataaaagagggaacagtccgccccgatctcgcgggaaaatttgttgcg
aatctgttttttgaaccgagcacgagaacgcggttcagctttgaagtggcggaaaagaaa
ctcggaatgaacgtgctcagcttagacgatacgagcacaagcgttcaaaaaggcgagtcc
ttatatgacacggtcaaaacactggaatcaatcggagcggacgcctgcgtcatccggcac
agcacggatgaatattacaaagatctgaccggcagagtcaatattccgatcttaaacgcc
ggcgacggctgcggccagcacccgactcagtcattgctcgatttaatgacgattcaagag
gaatttgagacctttcagggcctgacggtttccattcatggcgatatcaaacacagcagg
gtggcaaggtcgaatgccgaggtgctgacaaggctcggcgcacgcgtgctgttttctggt
ccgccgcaatggcaggatgagaaaaacgccttcggcacctgtgttcagacggatgaagcc
atacaagcttcagatgtcgtcatgctgctccgcatccaaaatgaaaggcatcagacagaa
gctgaccaaaaaggctacctggaagcatacgggctgaccgcaaagcgggcggagagcatg
aagcggcatgccatcatcatgcatcccgcaccggtgaacagaggagtcgaaattgacaca
acattagtggaatgcggaaaatcaagaatctttaaacaaatggaaaatggtgtgtatatc
agaatggcagtcttaaaaagagcactgcaaaccaatgtgaaaaggggagaagcggcttat
gtcttatctcattaa

DBGET integrated database retrieval system