KEGG   Bacillus amyloliquefaciens Y2: MUS_1719Help
Entry
MUS_1719          CDS       T02108                                 

Gene name
gmk
Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
bqy  Bacillus amyloliquefaciens Y2
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:bqy00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    MUS_1719 (gmk)
Enzymes [BR:bqy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     MUS_1719 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1620082..1620696
Genome map
AA seq 204 aa AA seqDB search
MKERGLLIVLSGPSGVGKGTVRQAIFSQQDTKFEYSISVTTRNPREGEVDGVDYFFKSRD
EFERMIENNKLLEWAEYVGNYYGTPVDYVEQTLQEGKDVFLEIEVQGALQVRNAFPEGLF
IFLAPPSLSELKNRIVTRGTETDDLIENRMNAAKAEIEMMDAYDYVVENDDIQTACDKIN
AIVLAEHLKRERVAPRYKKMLEVE
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaaagagggttattaatcgttctctcaggtccctccggagttggaaaaggaacg
gttcggcaagcaatattttcacaacaggacacgaaatttgaatactcaatttcagtcacg
acgagaaacccgagagagggcgaggtcgacggcgtcgattatttctttaaatcaagagat
gaattcgaacgcatgattgaaaacaacaaactgcttgagtgggcggaatatgtcggcaac
tattacggaacgcccgttgattatgtcgaacagacgcttcaagaaggaaaagacgtcttc
ttagagattgaagtgcagggcgcgctccaagtgcgtaatgcatttccggaaggcctgttt
atcttcttagcgccgccgagtctttctgagctgaaaaacagaatcgtgacaagagggact
gaaaccgacgatttaatcgaaaacagaatgaatgccgcaaaagctgaaatcgaaatgatg
gacgcgtatgattatgtcgttgaaaacgacgatatccaaacggcttgtgataagattaac
gcaatcgttctcgccgagcacttaaaacgtgaacgcgtcgctccgagatataagaaaatg
ctggaggtagaataa

DBGET integrated database retrieval system