KEGG   Bacillus amyloliquefaciens Y2: MUS_1797Help
Entry
MUS_1797          CDS       T02108                                 

Gene name
cheB
Definition
chemotaxis-specific methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
bqy  Bacillus amyloliquefaciens Y2
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:bqy02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:bqy02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1689898..1690956
Genome map
AA seq 352 aa AA seqDB search
MLVVDDSAFMRKMITDFLAAEVQIEVIGTARNGEEALKKIELLKPDVVTLDIEMPVMNGT
DTLRKIISIYKLPVIMVSSQTQQGKDRTINCLEMGAFDFITKPSGAISLDLYKIKEQLIE
RVIAAGLSRAQKPEAAVKESSIPERPALAGFERPKAKSAKQAVFIATSTGGPRALQKVIP
KLPKDLKAPVFVVQHMPEGFTASLADRLNHLSDIQVKEAENGEEAKDGWVYIAPGGKNMT
VAEEGGRLRIILDVHDTESRHKPSADYLFRSASRLSDYEKVAVIMTGMGSDGTEGVKEML
RTGGVKTIAESDESCVVFGMPKSAIKAGLIHEIKHVEDIAASITGCVKKERV
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
gtgcttgtcgttgatgactcagcttttatgagaaagatgattaccgattttctggctgcg
gaagtgcagatagaagtcatcgggacagccagaaacggggaagaggcgctgaagaaaata
gagcttctcaaaccggatgttgtcacgcttgatattgaaatgccggtcatgaacggaacg
gatacattgcggaagatcatcagcatatataaacttcccgtaatcatggtatcgagccag
acacaacaagggaaggaccgaacgatcaactgcctggaaatgggcgcttttgattttatc
accaagccttccggagcgatttcccttgatctttataaaattaaagagcagctgattgag
agggtgattgcagccgggctgtcccgcgcacaaaaacctgaggcggcagtgaaagagtct
tctatcccggaacgtccggctttagcgggatttgaaagaccgaaagcaaaatccgccaag
caggccgtattcatcgcgacctctacaggcggaccgcgggctctgcaaaaggtgattccg
aaactgccgaaggatttaaaggcgcctgtatttgtcgttcagcacatgcctgaaggcttc
accgcttcacttgcagacagactcaaccatttgtcagatattcaggtcaaagaagcggaa
aacggtgaagaagcgaaagacggatgggtgtacatcgcgcccggcggaaaaaatatgacg
gttgcagaggaaggcggaaggctccgcatcattcttgacgttcatgatacggaaagccgg
cataaaccgtcagccgattatttgtttcggtcggcaagccgcttatccgattacgaaaag
gtagccgtcattatgaccggcatgggcagcgacggaaccgaaggcgtaaaagaaatgctc
agaacaggcggcgttaaaacgattgcggaatcggacgaatcctgtgttgtgttcggaatg
ccgaagtcagcgataaaggcgggcctcattcatgagattaaacatgtggaagatatcgcg
gcatccatcaccggatgtgtgaaaaaagagagggtgtga

DBGET integrated database retrieval system