KEGG   Bacillus amyloliquefaciens Y2: MUS_2075Help
Entry
MUS_2075          CDS       T02108                                 

Gene name
xylA
Definition
xylose isomerase (EC:5.3.1.5)
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
bqy  Bacillus amyloliquefaciens Y2
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:bqy00040]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:bqy00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2004926..2006263
Genome map
AA seq 445 aa AA seqDB search
MAHSHSGSVNYFESVNKVIYEGKESTNPLAFKYYNSQEVIGGKTMKEHLRFSIAYWHTFT
ADGTDIFGAATMQRPWDHYKGMDLARARVDAAFELFEKLDAPFFAFHDRDIAPEGSTLKE
TNQNLDIIVDMIKDYMRTSGVKLLWNTANMFTNPRFVHGAATSCNADVFAYAAAQVKKGL
ETAKELGAENYVFWGGREGYETLLNTDLKFELDNMARFMHMAVDYAKEIGYTGQFLIEPK
PKEPTTHQYDTDAATTIAFLKQYGLDNHFKLNLEANHATLAGHTFEHELRMARVHGLLGS
VDANQGDPLLGWDTDEFPTDLYSATLAMYEILQNGGLGSGGLNFDAKVRRSSFEPDDLLY
AHVAGMDTFARGLKAAHKLIEDRVFEDVIQHRYRSFTEGVGLEIAEGRADFKTLEQYALN
NQSIKNESGRQERLKAILNQYILQV
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atggctcactctcattccggttcagtcaactattttgaaagcgtaaacaaagtgatttac
gaagggaaagaatccacgaatcctttagcatttaaatactataattctcaagaagtaatt
ggcggaaaaacgatgaaagagcatttgcgattttctattgcctattggcatacatttacc
gctgacggcacagacatttttggcgcagctacgatgcagagaccgtgggatcactataaa
ggcatggatctggcgagagcgagggtagatgcagcgtttgagctgtttgaaaaactggat
gcgccattttttgcttttcatgaccgggatatcgcaccggaaggaagtacgttaaaagag
acaaatcaaaatctggatataatcgtggacatgataaaagactacatgagaaccagcggc
gttaagctattatggaatactgcaaacatgtttacgaatccccgtttcgtccatggtgcg
gcgacttcttgtaatgcagatgtatttgcgtatgccgcagcccaagtaaaaaaaggatta
gaaaccgcaaaagagcttggcgccgagaactatgtattttggggcggacgtgaagggtac
gaaactttgttaaataccgatttaaaatttgagcttgataatatggccagatttatgcat
atggcagtggattatgcgaaggaaatcgggtatacagggcagtttttgattgaaccaaaa
ccaaaagagccgaccacccatcaatatgatacggacgcagcaacaaccattgccttttta
aagcaatatggcttagacaatcattttaaattaaatctcgaagccaatcatgccacatta
gccgggcatacattcgaacatgaattacgcatggcgagagtgcatggtctgcttggctct
gttgacgcgaatcagggtgatccgcttttaggctgggacacagatgaatttccgacagat
ttatattctgcgacattagcaatgtacgaaattctgcaaaatggcggtcttggaagcgga
ggattaaactttgacgcaaaggtcaggagatcttcttttgagcctgatgatttactatat
gcccatgttgcagggatggatacatttgcaagagggttgaaagccgcccacaaattaatc
gaagatcgtgtgtttgaagatgtgattcaacaccgttaccgcagctttactgaaggggtt
ggtcttgaaattgcagaaggaagagctgattttaagacacttgagcaatatgcgctaaac
aatcagtcaattaaaaacgaatcagggagacaggagcggttaaaagcgatattaaaccaa
tacattttacaggtataa

DBGET integrated database retrieval system