KEGG   Bacillus amyloliquefaciens Y2: MUS_2081Help
Entry
MUS_2081          CDS       T02108                                 

Gene name
adh
Definition
(GenBank) alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
bqy  Bacillus amyloliquefaciens Y2
Pathway
bqy00010  Glycolysis / Gluconeogenesis
bqy00071  Fatty acid degradation
bqy00350  Tyrosine metabolism
bqy00625  Chloroalkane and chloroalkene degradation
bqy00626  Naphthalene degradation
bqy01100  Metabolic pathways
bqy01110  Biosynthesis of secondary metabolites
bqy01120  Microbial metabolism in diverse environments
bqy01130  Biosynthesis of antibiotics
bqy01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bqy00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MUS_2081 (adh)
  Lipid metabolism
   00071 Fatty acid degradation
    MUS_2081 (adh)
  Amino acid metabolism
   00350 Tyrosine metabolism
    MUS_2081 (adh)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    MUS_2081 (adh)
   00626 Naphthalene degradation
    MUS_2081 (adh)
Enzymes [BR:bqy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     MUS_2081 (adh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N ADH_zinc_N_2 CdhD GFO_IDH_MocA 2-Hacid_dh_C Methyltransf_25 Methyltransf_11 Methyltransf_31
Motif
Other DBs
NCBI-ProteinID: AFJ62044
UniProt: I2C5X0
Position
complement(2014566..2015492)
Genome map
AA seq 308 aa AA seqDB search
MEYCGVCHTDLHVKNADFGDVTGVTLGHEGIGIVTEIGEGVTSLKKGDRVSIAWMFESCG
CCEYCLTGRETLCRDVKNAGYTVDGAMAEEAIVAVDYAIKVPENLDPAAASSITCAGVTT
YKAVKVSEIKPGQWIGVFGVGGLGNLAVQYAKNVFNAKVIAFDISDEKLNFAKSLGADAV
VNSLNEDPVAKAKEVTNDSGLDAVVITAVSKTPFNQAIDVVKAGARVVAVGLPVDKMDLD
IPRLVLDGIQVVGSLVGTREDLKEAFQFAADGKVVPKVTKRPIEDVNDIFEEMEQGKVTG
RMVIDFTS
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atggaatactgcggtgtatgtcatactgacttgcatgttaaaaatgctgatttcggggat
gttactggcgtcactttaggtcatgagggaataggcattgtaactgagatcggtgaaggt
gtaacaagtctgaaaaagggcgaccgcgtctctattgcctggatgtttgaaagctgcggc
tgctgtgaatattgcctaactggccgtgaaaccttgtgccgggatgtaaaaaatgccggc
tatacagttgacggcgcaatggctgaagaagcaatcgtagcggttgattatgcaataaag
gtgccggaaaatttagatcctgcagcagcaagcagcattacttgtgcaggtgtaacaact
tataaagcggttaaagtcagtgaaattaaaccaggtcaatggatcggtgtatttggagtc
ggcggtttaggcaacttggctgttcaatatgcaaaaaatgtctttaacgctaaagtaatt
gctttcgacattagcgatgaaaaattgaattttgctaagagcttaggcgctgatgcggtt
gtaaacagtttaaacgaagaccccgtcgctaaagcaaaagaagtgactaacgattcaggg
cttgatgctgtggtcatcacggctgtctctaaaacccctttcaatcaagcgattgatgtt
gtaaaagcaggagcccgtgtagtcgctgtcggtttaccggtggacaaaatggatttagat
attccccgtctcgtgttagatgggattcaggtagtaggttcattagtaggtaccagagaa
gatttgaaggaagcttttcaatttgccgcagacggtaaagttgtacctaaagtgacaaag
cgcccgattgaagatgtgaatgatatttttgaagaaatggagcaaggtaaagtgaccggc
cgcatggttatcgattttacttcctaa

DBGET integrated database retrieval system