KEGG   Bacillus amyloliquefaciens Y2: MUS_2161Help
Entry
MUS_2161          CDS       T02108                                 

Gene name
bglC
Definition
endo-beta-1,4-glucanase (EC:2.3.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
bqy  Bacillus amyloliquefaciens Y2
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bqy00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MUS_2161 (bglC)
Enzymes [BR:bqy01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     MUS_2161 (bglC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2073427..2074932)
Genome map
AA seq 501 aa AA seqDB search
MKRSISIFITCLLIAVLTMGGLLPSPASAAGTKTPVAKNGQLSIKGTQLVNRDGKAVQLK
GISSHGLQWYGDFVNKDSLKWLRDDWGITVFRAAMYTADGGYIDNPTVKNKVKEAVEAAK
ELGIYVIIDWHILNDGNPNQNKEKAKEFFKEMSSLYGNTPNVIYEIANEPNGDVNWKRDI
KPYAEEVISVIRKNDPDNIIIVGTGTWSQDVNDAADDQLKDANVMYALHFYAGTHGQSLR
DKANYALSKGAPIFVTEWGTSDASGNGGVFLGQSREWLNYLDSKNISWVNWNLSDKQESS
SALKPGASKTGGWPLTDLTASGTFVRENIRGYKDSTKERPETPAQDNPTQEKGISVQYKA
GDGRVNSNQIRPQLHIKNNGDATVDLKDVTARYWYNVKNKGQNFDFDCDYAQIGCGNLTH
KFVTLHKPKQGADTYLELGFKTGTLSPGASTGNIQLRLHNDDWSNYAQSGDYSFFQSNTF
KTTKKITLYHQGKLIWGTEPN
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgaaacggtcaatttctatttttattacgtgtttattgattgcggtattgacaatgggc
ggcttgctgccttcgccggcatctgcagcagggacaaaaacgccagtagccaagaatggt
cagcttagcataaaaggtacacaactcgtaaaccgagacggcaaagcggtacaactgaaa
gggatcagttcacatggattgcaatggtatggcgatttcgtcaataaagacagcttaaaa
tggctgagagacgattggggcatcaccgttttccgcgcggcaatgtatacggcagatggc
ggttatattgacaacccgaccgtgaaaaataaagtaaaagaagcggttgaagcggcaaaa
gaacttgggatatatgtcatcattgactggcatatcttaaatgacggcaacccaaaccaa
aataaagagaaggcaaaagaatttttcaaggagatgtcaagtctttacggaaacacgcca
aacgtcatttatgaaattgcaaacgaaccaaacggtgacgtgaactggaagcgtgatatt
aaaccgtatgcggaagaagtgatttccgttatccgcaaaaatgatccagacaacatcatc
attgtcggaaccggtacatggagccaggatgtgaatgatgctgccgatgaccagctaaaa
gatgcaaacgtcatgtacgcgcttcatttttatgccggcacacacggccaatctttacgg
gataaagcaaactacgcactcagcaaaggagcgcctattttcgtgacggaatggggaaca
agcgatgcgtctggaaatggcggtgtattccttggccagtcgcgggaatggctgaattat
ctcgacagcaagaacatcagctgggtgaactggaatctttctgataagcaggaatcatcc
tcggctttaaagccgggagcatctaaaacaggcggctggccgcttacagatttaactgct
tcaggaacattcgttagagaaaacattcgcggctacaaagattcaacgaaagaacgccct
gaaacgccagcacaagataaccccacacaggaaaaaggtatttctgtacaatacaaagca
ggggatgggcgtgtgaacagcaatcaaatccgcccgcagcttcacataaaaaataacggc
gatgcgacggtggatttaaaagatgtcactgcccgttactggtataacgtgaaaaacaaa
ggccaaaactttgactttgactgtgactacgcgcagattggatgcggcaatctgacccac
aaatttgtgacgctgcataaacctaagcaaggtgcagatacctatctggaactggggttt
aaaacaggaacgctgtcaccgggagcaagcacagggaatattcagcttcgtcttcacaat
gatgactggagcaattatgcacaaagcggcgattattcctttttccaatcaaatacgttt
aaaacaacgaaaaaaatcacattatatcatcaaggaaaactgatttggggaacagaaccc
aattag

DBGET integrated database retrieval system