KEGG   Bacillus amyloliquefaciens Y2: MUS_2185Help
Entry
MUS_2185          CDS       T02108                                 

Gene name
yngB
Definition
UTP--glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bqy  Bacillus amyloliquefaciens Y2
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bqy00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    MUS_2185 (yngB)
   00052 Galactose metabolism
    MUS_2185 (yngB)
   00500 Starch and sucrose metabolism
    MUS_2185 (yngB)
   00520 Amino sugar and nucleotide sugar metabolism
    MUS_2185 (yngB)
Enzymes [BR:bqy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     MUS_2185 (yngB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2129657..2130550
Genome map
AA seq 297 aa AA seqDB search
MRKKVRKAVIPAAGLGTRFLPATKAQPKEMLPIVDKPAIQYIVEEAAASGIEDILIITGR
NKRSIEDHFDRSAELEFNLREKGKTETLKEMQQIADLANIHYIRQKEPLGLGHAVLCAEH
FIGDEPFAVLLGDDIMVSDTPALSQLIDVYNQHGTETIGVQPVDPADVSKYGIIQTGRQS
GHVYQVEDLIEKPAVEKAPSHIAVMGRYILTPAIFKTLKTIGRGAGNEIQLTDALREVCR
TRSIYARELEGSRFDIGDKFGCFMAGTEIGLLREEMRPKLLAYLEEVLKRESEEIVR
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaaaagtgagaaaagcggtcattcccgcagcaggtttaggaacgagatttctg
ccggcgacaaaggcgcagccgaaagaaatgctgccgattgtcgacaaaccggccatccaa
tatattgtcgaagaggccgcagcgtcaggaattgaagatatactgattattacagggaga
aacaaacgctcgattgaagatcattttgaccggtcggcggaattggaattcaatctgcgg
gaaaaaggcaagacggagacgctgaaggagatgcagcagatcgccgatttggccaatatt
cattacatccgtcagaaagaaccgctcggattaggacatgcggtgctgtgtgcggagcat
tttatcggagatgagccttttgccgttctcttaggtgatgatattatggtatctgacact
cccgctctttcacagctcatagacgtctataaccaacacggcacagaaacgatcggcgta
cagcccgtcgatcctgctgatgtcagcaaatatggtattatacagacggggcggcagagc
ggtcatgtataccaggttgaggatctgattgagaaaccggctgttgaaaaggcgccctct
catattgccgtgatgggccgctacatattaacccctgctatttttaaaacgctgaagacg
atcggaagaggcgcgggcaacgaaatccaattgacagacgcgctgcgcgaagtgtgccgc
acccgaagcatttatgcgcgggagcttgaaggaagccggtttgatataggagataagttc
ggctgttttatggccggcacggagatcgggcttctgcgggaagaaatgagaccgaaactt
ttagcttatttagaagaggtgttaaaaagagaatctgaagaaatcgtgcgctaa

DBGET integrated database retrieval system