KEGG   Bacillus amyloliquefaciens Y2: MUS_2228Help
Entry
MUS_2228          CDS       T02108                                 

Gene name
proJ
Definition
(GenBank) Dgamma-glutamyl kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
bqy  Bacillus amyloliquefaciens Y2
Pathway
bqy00330  Arginine and proline metabolism
bqy00332  Carbapenem biosynthesis
bqy01100  Metabolic pathways
bqy01130  Biosynthesis of antibiotics
bqy01230  Biosynthesis of amino acids
Module
bqy_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:bqy00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    MUS_2228 (proJ)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    MUS_2228 (proJ)
Enzymes [BR:bqy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     MUS_2228 (proJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA DUF2138
Motif
Other DBs
NCBI-ProteinID: AFJ62180
UniProt: I2C6A6
Position
complement(2201453..2202538)
Genome map
AA seq 361 aa AA seqDB search
MKIGSSSLTSLHGEISRRKLEALVDQIAQLKDSGYEVILVSSGAVAAGYRKLGFIQKPES
LPEKQASASIGQGLLMEAYSKLFLAHGYVASQILITRSDFSDEYRYHNVRNTMNVLLERG
IIPIINENDTVTVNRLKFGDNDTLAAKVAGLIDADMLVILSDIDGLYDDNPRSNPKAKRI
RHVSDITPEIEASAGDAGSEMGTGGMRSKLDAFKIVMASGIKGFLGQANIPDILLQAVDE
AAEGTYFEAEGTLPLNHKEQWLAFNSGPEGEIVMEKESSRDVANGNMELSPQDIEQIKGR
FSSGAVVRLLDQQGEELGLGIVNYSSAQLKTFKETPHKQGDQSVIDPEAFVCHVELSIPI
G
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaatcggcagcagctcactgacgagcctgcacggggaaatcagcagaagaaagctg
gaagcattggtggatcaaatcgcacagctgaaagacagcggctatgaagtgattttagta
tcttccggcgcagtggcggcaggttatcggaagctcggatttattcagaaaccggaaagc
ctccctgaaaaacaggcttctgcttccatcgggcagggattattaatggaggcttattca
aagctgtttttagcgcacggttatgtcgcatcacaaatattaattacaagaagcgacttt
tccgatgaataccgctaccataatgtgcgcaatacgatgaacgtccttttggaacggggc
attattccgattattaatgaaaatgacacggtcacagtcaaccggctgaaattcggagat
aacgatacactcgcagcgaaggtggcaggtttaattgatgccgacatgcttgtgatttta
tcagacattgacggtttatatgatgataatccgcgcagcaacccgaaggcgaaaagaatc
agacatgtaagtgacattaccccggaaatagaagcgagcgcgggagatgccgggagtgaa
atgggaaccggcggaatgcgttcgaaactggatgcttttaaaattgtgatggcctccggt
attaaaggctttctcgggcaggctaacattccggacattctgcttcaagcggtagatgag
gcggctgaaggaacttattttgaagcggaaggaaccctgccgttaaaccacaaagaacaa
tggcttgcatttaattccggccccgaaggtgaaattgtgatggaaaaagaaagcagccgc
gatgtcgcgaacggaaatatggagctgtcaccgcaggacatcgagcagattaagggcaga
ttcagcagcggagcggttgtcaggctgcttgatcagcagggagaagagctcggacttggc
atcgtcaactattcctcagcccagctgaagacatttaaagaaacgccgcataaacagggc
gatcaatcagtcattgatccggaagcatttgtctgccacgttgaactatccattccgatc
ggctga

DBGET integrated database retrieval system