KEGG   Bacillus amyloliquefaciens Y2: MUS_2228Help
Entry
MUS_2228          CDS       T02108                                 

Gene name
proJ
Definition
Dgamma-glutamyl kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
bqy  Bacillus amyloliquefaciens Y2
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:bqy01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:bqy00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2201453..2202538)
Genome map
AA seq 361 aa AA seqDB search
MKIGSSSLTSLHGEISRRKLEALVDQIAQLKDSGYEVILVSSGAVAAGYRKLGFIQKPES
LPEKQASASIGQGLLMEAYSKLFLAHGYVASQILITRSDFSDEYRYHNVRNTMNVLLERG
IIPIINENDTVTVNRLKFGDNDTLAAKVAGLIDADMLVILSDIDGLYDDNPRSNPKAKRI
RHVSDITPEIEASAGDAGSEMGTGGMRSKLDAFKIVMASGIKGFLGQANIPDILLQAVDE
AAEGTYFEAEGTLPLNHKEQWLAFNSGPEGEIVMEKESSRDVANGNMELSPQDIEQIKGR
FSSGAVVRLLDQQGEELGLGIVNYSSAQLKTFKETPHKQGDQSVIDPEAFVCHVELSIPI
G
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaatcggcagcagctcactgacgagcctgcacggggaaatcagcagaagaaagctg
gaagcattggtggatcaaatcgcacagctgaaagacagcggctatgaagtgattttagta
tcttccggcgcagtggcggcaggttatcggaagctcggatttattcagaaaccggaaagc
ctccctgaaaaacaggcttctgcttccatcgggcagggattattaatggaggcttattca
aagctgtttttagcgcacggttatgtcgcatcacaaatattaattacaagaagcgacttt
tccgatgaataccgctaccataatgtgcgcaatacgatgaacgtccttttggaacggggc
attattccgattattaatgaaaatgacacggtcacagtcaaccggctgaaattcggagat
aacgatacactcgcagcgaaggtggcaggtttaattgatgccgacatgcttgtgatttta
tcagacattgacggtttatatgatgataatccgcgcagcaacccgaaggcgaaaagaatc
agacatgtaagtgacattaccccggaaatagaagcgagcgcgggagatgccgggagtgaa
atgggaaccggcggaatgcgttcgaaactggatgcttttaaaattgtgatggcctccggt
attaaaggctttctcgggcaggctaacattccggacattctgcttcaagcggtagatgag
gcggctgaaggaacttattttgaagcggaaggaaccctgccgttaaaccacaaagaacaa
tggcttgcatttaattccggccccgaaggtgaaattgtgatggaaaaagaaagcagccgc
gatgtcgcgaacggaaatatggagctgtcaccgcaggacatcgagcagattaagggcaga
ttcagcagcggagcggttgtcaggctgcttgatcagcagggagaagagctcggacttggc
atcgtcaactattcctcagcccagctgaagacatttaaagaaacgccgcataaacagggc
gatcaatcagtcattgatccggaagcatttgtctgccacgttgaactatccattccgatc
ggctga

DBGET integrated database retrieval system