KEGG   Bacillus amyloliquefaciens Y2: MUS_2286Help
Entry
MUS_2286          CDS       T02108                                 

Gene name
odhB
Definition
(GenBank) 2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase)
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
bqy  Bacillus amyloliquefaciens Y2
Pathway
bqy00020  Citrate cycle (TCA cycle)
bqy00310  Lysine degradation
bqy01100  Metabolic pathways
bqy01110  Biosynthesis of secondary metabolites
bqy01120  Microbial metabolism in diverse environments
bqy01130  Biosynthesis of antibiotics
bqy01200  Carbon metabolism
Module
bqy_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bqy_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bqy00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MUS_2286 (odhB)
  Amino acid metabolism
   00310 Lysine degradation
    MUS_2286 (odhB)
Enzymes [BR:bqy01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     MUS_2286 (odhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: AFJ62232
UniProt: I2C6F8
Position
complement(2240552..2241799)
Genome map
AA seq 415 aa AA seqDB search
MAEIKVPELAESISEGTIAQWLKQPGDYVEQGEYLLELETDKVNVELTAEESGVLKEVLK
DSGDTVQVGEIIGTITEGAGESSAPAPSESAPANEQTKEEAKAEPAAQEVSQEAQSEAKS
RTIASPAARKLAREKGIDLSQIPTGDPLGRVRKQDVEAYEKPASKPAAQPKQQAQKTQQS
FDKPVEVQKMSRRRQTIAKRLVEVQQTSAMLTTFNEVDMTAVMNLRKRRKDQFLEQNDVK
LGFMSFFTKAVVAALKKFPLLNAEIQGDELIVKKFYDIGIAVAAEEGLVVPVVRDADRLT
FAGIEREIGELAKKARNNKLTLGELQGGSFTITNGGTFGSLMSTPILNSPQVGILGMHKI
QLRPVAIDAERSENRPMMYIALSYDHRIVDGKEAVGFLVTIKNLLEDPEQLLLEG
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaattaaggtacctgaattagcagaatcaatctcagaaggaacgatagcccaa
tggttaaagcagcccggtgattatgtagaacagggtgagtacttgcttgaactggagacg
gacaaagtaaatgttgaattgacagcagaagaatcgggtgttctaaaagaggtattgaaa
gattcgggtgataccgtccaagtaggagaaattatcggtaccattacagaaggcgctggc
gaaagttctgcacccgccccttcagaaagtgctccagccaatgaacaaacgaaagaggaa
gcaaaagctgaacctgctgcacaagaagtcagccaggaagcacaatcagaagcgaaatcc
agaacgatagcgtctccggctgcacgcaagctggcaagggaaaaagggattgatctatca
caaattccgacgggggacccgctcggccgcgtgcgcaagcaagatgtggaagcttatgaa
aaaccggcttcaaaacctgcggcacagccgaaacagcaggctcaaaaaacacagcaaagc
tttgacaaacctgtcgaagtgcaaaaaatgtcccgccgcagacagacgatcgcgaaacga
ttggttgaagtgcagcagacttctgcgatgctgactacatttaacgaagttgacatgacg
gccgttatgaatctaagaaaacgccgtaaagaccaattccttgagcaaaacgatgtaaaa
ctcggtttcatgtcgttctttacaaaagccgtcgtggctgcattgaaaaaattcccgctc
cttaacgctgaaattcaaggcgatgagctgatcgtgaaaaaattctatgacatcggtatc
gctgtcgcggctgaagaagggcttgtcgtcccagtcgtgcgtgacgctgaccgcctgacg
tttgccggcattgaaagagagatcggcgaacttgcgaaaaaagcgcgaaacaataaatta
acattaggtgagctgcaaggaggctccttcacgatcacaaacggaggtacattcggatcg
cttatgtcaacaccgatcctaaacagccctcaggttgggatcttaggtatgcacaaaatt
cagctgcgcccagtagcgattgatgcggagcgctctgaaaaccgtccgatgatgtacatc
gctttatcatatgatcacagaattgtagatggtaaagaagcggtcggattcctcgtcacc
attaaaaacctgcttgaagatccggaacagctgttgctggaaggataa

DBGET integrated database retrieval system