KEGG   Bacillus amyloliquefaciens Y2: MUS_2312Help
Entry
MUS_2312          CDS       T02108                                 

Definition
glucosylceramidase (EC:3.2.1.45)
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
bqy  Bacillus amyloliquefaciens Y2
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bqy00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    MUS_2312
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    MUS_2312
Enzymes [BR:bqy01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     MUS_2312
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2263214..2264689)
Genome map
AA seq 491 aa AA seqDB search
MFFKKGLHMTLVFLMFFFFISSSMTEVYAADRKASDKNKVRVWFSSEKDPASRTWYDGPQ
EVKYALDEQTPLTLTKKKASDTAAVYIDPSRRYQSVLGVGSSLEESTIHNLSKMTPAKRK
EVLKKLVDPKDGIGMDVMRITIGTSDFTAQEFYTYDDMPEGQTDPKLRHFSIQKDIDLHI
TATIKEALAINPELKIIASPWSPPAWMKTNENLKRGKLKDKYIGELAVYFRKFIEAYEKQ
GIPIYAMTLQNEPLLEIDYPSMYMSPSQQRKLALALKKEMKKHVIDTKIWIYDHNASGAW
NYIPPILDDKKGNRAADGIAFHDYDGDLSVMSEIGKRYPDQSIHLTERSVWGTAGADRIA
QYFRNGASSYNAWVTMLDSQIKTHHWIGTPDPTLFIQDAKNPDRYWNIPIFHMTGNFSKF
IDRGAKRIESNYGSKNTVSNVSFLNPDQSIVTVVINQTSADQKFHVVSENRQFEAVIPAK
TVATYKWKQKK
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgttttttaaaaaaggtctgcacatgacgctggtttttcttatgtttttctttttcata
tcaagcagcatgaccgaagtgtatgcggctgatcggaaggcttcagacaaaaacaaagta
agggtgtggttcagttctgaaaaagatccggcttcccgtacgtggtatgacgggccgcag
gaagtgaaatacgccttagacgaacaaacaccgcttacattgacaaaaaagaaggcttct
gacaccgccgccgtgtatattgatccgtcgcgccgctatcaaagtgtgttaggcgtagga
tcgtccctggaagaatccacaatccataatttatcaaaaatgacacccgcaaaaagaaaa
gaagtgctgaaaaaactggttgatcccaaagatggtatcggcatggacgttatgcgcata
acaatcgggacatctgattttacggcacaggaattttatacgtatgatgatatgcctgaa
ggccaaacagatcctaagctccgtcatttctcgatccaaaaggatattgatttacacatt
acagcaaccatcaaggaagcgctggcgataaatccggaactgaaaatcattgcttcaccg
tggagcccgccggcttggatgaaaacgaatgaaaaccttaagcggggaaagctgaaagat
aaatatatcggcgaactggccgtttacttccgcaaatttattgaggcgtacgaaaagcaa
ggaattccgatttatgccatgacccttcaaaatgaacctttgctggaaatcgactatccg
agcatgtatatgtcgccgtctcagcagcgcaaactggcactggccttaaaaaaagaaatg
aaaaaacacgtaattgacacgaaaatttggatttatgatcacaatgcgagcggggcgtgg
aactatattccgccgattttagatgataaaaaaggaaaccgggcggcagacggcatcgct
tttcacgattatgacggtgacctttccgtcatgtcggagatcggaaagagatatcctgat
caatctattcacttaacggagcggtctgtctgggggacggcaggggcggaccggatcgcg
cagtatttccgcaacggcgcgtcgagctacaatgcgtgggtgacgatgctcgacagtcaa
atcaagacgcatcattggataggcaccccagacccgacgctgtttattcaggatgctaaa
aaccctgaccgctattggaatatcccgatctttcatatgacaggcaacttttcaaaattt
atcgaccggggagcaaagcggatagaaagtaattacggctccaaaaacacagtctcgaat
gtatcgttccttaatcctgatcaatccattgtgacagtcgtaatcaaccagacatccgcc
gaccaaaaattccatgtcgtttcagaaaatcggcagtttgaagccgtcatcccggctaaa
accgtggctacctacaaatggaagcaaaaaaagtaa

DBGET integrated database retrieval system