KEGG   Bacillus amyloliquefaciens Y2: MUS_2357Help
Entry
MUS_2357          CDS       T02108                                 

Gene name
dfrA
Definition
dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
bqy  Bacillus amyloliquefaciens Y2
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:bqy00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:bqy00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2297056..2297541)
Genome map
AA seq 161 aa AA seqDB search
MISFIFAMDENRLIGKDNDLPWHLPDDLAYFKKVTTGHTIVMGRKTFESIGRPLPNRRNI
VVTSRDESLFPGCITADSAEEVLKLIPPDEECFVIGGAQLYSALFPYADRLYMTKIHHVF
EGDRFFPEFNEAEWELTSRKQGVKDEKNPYDYEYLVYEKKN
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgatttcgtttatttttgcgatggatgaaaaccggctgatcggaaaagataacgatctg
ccttggcaccttcccgatgatctcgcatatttcaaaaaagtgacgacgggtcacaccatt
gtaatggggcggaaaacgtttgaatcaatcggacgcccgcttccgaaccggcgtaacatc
gttgtaacctcacgggacgaatctttattcccgggctgtattaccgccgactcggctgag
gaagtgctcaagctgatcccgcccgatgaagaatgctttgtgatcggcggcgcccagctg
tacagtgcgctctttccttatgcggacaggctctacatgacaaaaattcaccatgtcttt
gaaggagaccgtttttttccggaatttaatgaagctgaatgggaattgacatcccgcaaa
cagggagtaaaagatgaaaaaaacccttacgattatgagtaccttgtatacgagaaaaag
aattga

DBGET integrated database retrieval system