KEGG   Bacillus amyloliquefaciens Y2: MUS_2509Help
Entry
MUS_2509          CDS       T02108                                 

Gene name
trpA
Definition
(GenBank) 3-dehydroquinate dehydratase (EC:4.2.1.10)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
bqy  Bacillus amyloliquefaciens Y2
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bqy00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MUS_2509 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MUS_2509 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MUS_2509 (trpA)
Enzymes [BR:bqy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     MUS_2509 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2413659..2414456)
Genome map
AA seq 265 aa AA seqDB search
MFNLRDSEKLFIPFITAGDPLPDISVELAISLQNAGASALEIGVPYTDPLADGPVIQRAS
KRALENGMNIVKAIELGGKMKKNGVHIPIILFTYYNPVLQLEKEYFFALLRENDIDGLLV
PDLPLEESALLQMTCKKENIAYISLVAPTSEDRLKIITEQASGFVYCVSSLGVTGVRSEF
DPSVYSFIRKVKEFSSVPVAVGFGISNRKQVDGMNEISDGVVVGSALVKKVEELKTKLVN
PGTRADALLEFEEYAKTFGRLYSVK
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgtttaatctgcgagattctgaaaaattatttatcccttttattacagctggcgatccg
cttcctgacatttctgttgagctggcaatatcattgcagaatgcaggcgcttctgccctt
gagatcggcgttccttacacagatccgctcgcggacggacccgtcatacaacgggcttca
aaacgggctctggaaaacggaatgaatatcgtaaaagcaattgaacttggcggcaaaatg
aaaaaaaacggcgttcatattccaattatcctctttacgtattataatcctgtgttacaa
ttagaaaaagaatactttttcgctttactgcgggaaaacgacatagacggtctgcttgta
cccgaccttccattagaggaaagcgcccttttgcaaatgacatgcaaaaaggagaacatc
gcttatatctcactggttgcgccgacaagtgaagaccgtttgaaaataattactgaacag
gccagcggctttgtgtattgtgtatcctctttaggagtgacgggcgtacgcagcgaattc
gatccgtctgtatactctttcattcgtaaggtgaaagaattcagctctgttccggtggcg
gtcggttttggcatttcaaaccgcaaacaggttgacgggatgaatgaaatatctgacggt
gtcgttgtcggcagcgcgcttgtcaaaaaagttgaagagcttaaaacaaagcttgtgaat
cccggaacaagagctgatgcgcttcttgaatttgaagaatacgcaaagacgttcggacga
ctgtacagtgtaaaatga

DBGET integrated database retrieval system