KEGG   Bacillus amyloliquefaciens Y2: MUS_2511Help
Entry
MUS_2511          CDS       T02108                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
bqy  Bacillus amyloliquefaciens Y2
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bqy00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MUS_2511 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MUS_2511 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MUS_2511 (trpB)
Enzymes [BR:bqy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     MUS_2511 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2414449..2415177)
Genome map
AA seq 242 aa AA seqDB search
MVPVTSGNGTLKDATNEAIRYWVQHCEDHFYLIGSVVGPHPYPYIVREFQKIIGEEAKEQ
LRRVEGTLPDKVVACVGGGSNAMGIFQAFLDEDTELIGAEAAGKGIDTPLHAATIAKGTL
GVIHGSMTYLIQDEYGQIIEPYSISAGLDYPGIGPEHAYLHKSGRVTYESVTDDEAIAAL
RLLSETEGILPAIESAHALAKAFEMAKDMDKDKIILVSLSGRGDKDVHTLMNVLENGVET
HV
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
gtggtgccggtcacaagcggcaacggcacgctgaaagatgcgacgaatgaggcaatcagg
tattgggtccagcattgtgaagatcatttctaccttatcggttctgtagtggggccgcac
ccgtatccgtatatcgttcgcgaatttcagaaaatcatcggcgaggaagcgaaagaacag
ctccgccgggttgaaggaacgctcccggataaggttgttgcatgtgtcggcggcggaagc
aatgcgatgggcatttttcaggcctttttagacgaagatactgagctgatcggcgccgag
gcggccggaaaaggaattgatacgccgctgcatgcggcaacgatcgcaaaagggacgctc
ggggtgattcacggttcaatgacctatttaatacaagatgaatacgggcagattatcgaa
ccgtactccatttcagcaggccttgattacccggggatcggccctgagcacgcctatctg
cataaaagcggccgtgtaacgtacgaaagcgtgacagacgatgaagcgattgccgcgtta
cgtctgctttctgaaacagaaggtattcttccggctattgaatctgcccacgccctggca
aaagcgtttgaaatggcaaaagacatggataaagataaaatcattctcgtcagtttgtcg
ggaagaggagataaagatgttcatacgctgatgaatgttttggaaaacggggtggagaca
catgtttaa

DBGET integrated database retrieval system