KEGG   Bacillus amyloliquefaciens Y2: MUS_2511Help
Entry
MUS_2511          CDS       T02108                                 

Gene name
trpB
Definition
tryptophan synthase (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
bqy  Bacillus amyloliquefaciens Y2
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bqy00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MUS_2511 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MUS_2511 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MUS_2511 (trpB)
Enzymes [BR:bqy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     MUS_2511 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2414449..2415177)
Genome map
AA seq 242 aa AA seqDB search
MVPVTSGNGTLKDATNEAIRYWVQHCEDHFYLIGSVVGPHPYPYIVREFQKIIGEEAKEQ
LRRVEGTLPDKVVACVGGGSNAMGIFQAFLDEDTELIGAEAAGKGIDTPLHAATIAKGTL
GVIHGSMTYLIQDEYGQIIEPYSISAGLDYPGIGPEHAYLHKSGRVTYESVTDDEAIAAL
RLLSETEGILPAIESAHALAKAFEMAKDMDKDKIILVSLSGRGDKDVHTLMNVLENGVET
HV
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
gtggtgccggtcacaagcggcaacggcacgctgaaagatgcgacgaatgaggcaatcagg
tattgggtccagcattgtgaagatcatttctaccttatcggttctgtagtggggccgcac
ccgtatccgtatatcgttcgcgaatttcagaaaatcatcggcgaggaagcgaaagaacag
ctccgccgggttgaaggaacgctcccggataaggttgttgcatgtgtcggcggcggaagc
aatgcgatgggcatttttcaggcctttttagacgaagatactgagctgatcggcgccgag
gcggccggaaaaggaattgatacgccgctgcatgcggcaacgatcgcaaaagggacgctc
ggggtgattcacggttcaatgacctatttaatacaagatgaatacgggcagattatcgaa
ccgtactccatttcagcaggccttgattacccggggatcggccctgagcacgcctatctg
cataaaagcggccgtgtaacgtacgaaagcgtgacagacgatgaagcgattgccgcgtta
cgtctgctttctgaaacagaaggtattcttccggctattgaatctgcccacgccctggca
aaagcgtttgaaatggcaaaagacatggataaagataaaatcattctcgtcagtttgtcg
ggaagaggagataaagatgttcatacgctgatgaatgttttggaaaacggggtggagaca
catgtttaa

DBGET integrated database retrieval system