KEGG   Bacillus amyloliquefaciens Y2: MUS_2511Help
Entry
MUS_2511          CDS       T02108                                 

Gene name
trpB
Definition
tryptophan synthase (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
bqy  Bacillus amyloliquefaciens Y2
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:bqy01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:bqy00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:bqy00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2414449..2415177)
Genome map
AA seq 242 aa AA seqDB search
MVPVTSGNGTLKDATNEAIRYWVQHCEDHFYLIGSVVGPHPYPYIVREFQKIIGEEAKEQ
LRRVEGTLPDKVVACVGGGSNAMGIFQAFLDEDTELIGAEAAGKGIDTPLHAATIAKGTL
GVIHGSMTYLIQDEYGQIIEPYSISAGLDYPGIGPEHAYLHKSGRVTYESVTDDEAIAAL
RLLSETEGILPAIESAHALAKAFEMAKDMDKDKIILVSLSGRGDKDVHTLMNVLENGVET
HV
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
gtggtgccggtcacaagcggcaacggcacgctgaaagatgcgacgaatgaggcaatcagg
tattgggtccagcattgtgaagatcatttctaccttatcggttctgtagtggggccgcac
ccgtatccgtatatcgttcgcgaatttcagaaaatcatcggcgaggaagcgaaagaacag
ctccgccgggttgaaggaacgctcccggataaggttgttgcatgtgtcggcggcggaagc
aatgcgatgggcatttttcaggcctttttagacgaagatactgagctgatcggcgccgag
gcggccggaaaaggaattgatacgccgctgcatgcggcaacgatcgcaaaagggacgctc
ggggtgattcacggttcaatgacctatttaatacaagatgaatacgggcagattatcgaa
ccgtactccatttcagcaggccttgattacccggggatcggccctgagcacgcctatctg
cataaaagcggccgtgtaacgtacgaaagcgtgacagacgatgaagcgattgccgcgtta
cgtctgctttctgaaacagaaggtattcttccggctattgaatctgcccacgccctggca
aaagcgtttgaaatggcaaaagacatggataaagataaaatcattctcgtcagtttgtcg
ggaagaggagataaagatgttcatacgctgatgaatgttttggaaaacggggtggagaca
catgtttaa

DBGET integrated database retrieval system