KEGG   Bacillus amyloliquefaciens Y2: MUS_3007Help
Entry
MUS_3007          CDS       T02108                                 

Gene name
yrrC
Definition
exodeoxyribonuclease V subunit alpha (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
bqy  Bacillus amyloliquefaciens Y2
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:bqy03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2857803..2860181)
Genome map
AA seq 792 aa AA seqDB search
MDQLNIEEQPYVKGVIHTVIYHNDTNLYTVLKVKVAETSEAIEDKVVSVTGYFPLLQEDE
TYTFYGKTATHPKFGLQFQAEHFKKEIPTTKEGIIHYLSSDLFEGIGKKTAEEIVKKLGD
GALNKILTDASVLYDVPKMSKKKADKLAGELQRHQGLEQIMISLNQYGFGPQLSMKIYQA
YETETLEKIQENPYQLVKDVEGIGFVKADELGGKMGLSGNHPERIKAAILYTIESTCLSE
GHTYIETKQLIINTQTLLNQSAEGGRVTEMDAADGIIALGESKDIVIEGERCYFPSLFYA
EQNVAKRVLDIAAQTEYADQFPESEFLLALGELEERMNVQYAPSQKDAIQKALSSPMLLL
TGGPGTGKTTVIKGIVELYSELHGVSLDPGDYKKDETFPVLLAAPTGRAAKRMSESTGLP
AVTIHRLLGWNGAEGFTYNEDQPIEGKLIIIDEASMLDIWLASHLFKALPKHIQLIVVGD
EDQLPSVGPGQVLRDLLASEVLPTVRLTDIYRQAEGSSIVELAHDMKKGLLPKGLTAPTK
DRSFIRCNSSQMKEVVDQVVSNALKKGYTSRDIQVLAPMYRGKAGINELNMLLQDIMNPP
KEKRRELKFGDVVYRTGDKILQLVNQPENNVFNGDIGEIVSIFYAKENTEKEDMVVVSFD
GNEITFTKKDFSQFTHAYCCSIHKSQGSEFPIVVLPVVKGYYRMLRRNLLYTAITRAKKF
LILCGEEEALEWGVKNNDATVRQTSLKNRLTEQTEEMDAELAALQKELPFSVYDANIGME
GITPFDFMEEKA
NT seq 2379 nt NT seq  +upstreamnt  +downstreamnt
gtggatcagctgaacatcgaagaacagccgtatgtaaaaggcgtcattcatacggtcatt
tatcataatgacaccaacctgtatacagtgctgaaagtcaaagttgcagaaacgtctgag
gcgatcgaagacaaggtcgtatccgtaacgggctacttccctctgctgcaagaagatgag
acctacacattttatggaaaaaccgccacgcatcctaagttcggcctgcaatttcaggct
gaacactttaaaaaagaaattccgaccacaaaagaagggatcattcactatttatcaagt
gatctgtttgaaggaatcggaaaaaaaacggcggaagaaatcgtcaaaaagctcggagac
ggcgcgctcaataaaattctgacggatgcgtcggtgctttacgatgtgccgaaaatgtcg
aaaaagaaagcggataagcttgccggagagctgcagcggcatcaggggcttgagcagatt
atgatctctctgaaccaatacggtttcgggccccagctatcaatgaaaatatatcaggcc
tacgaaacggaaaccctggagaaaattcaggaaaatccttatcagcttgtaaaagacgtt
gaaggcatcggctttgtgaaagctgacgagctgggcggaaaaatgggtctgtcaggaaac
cacccggagcggatcaaagcggcaatcttatatacgattgaatcgacctgtctttcagaa
ggccatacgtacatagagacaaagcagctgattatcaatacgcaaacgctcctgaatcag
tcagctgaaggcggccgcgtcacggagatggatgcggctgacggcatcatcgccctcggg
gagagtaaggatatcgtcatagaaggagagcgctgctattttccgtccttgttttacgcc
gaacaaaatgtcgcaaaacgcgtgctcgacattgcggctcagacggagtatgccgatcaa
tttcctgaatcggaatttctgcttgcactcggtgaactggaagaacggatgaatgttcaa
tacgcaccaagccaaaaggatgccattcaaaaagcgctgtcttcaccgatgcttttattg
accggaggacccgggacggggaaaacgaccgttattaaaggaatcgtggaattatacagt
gaactgcacggagtatcgcttgaccccggtgattataaaaaagacgagacgttcccggtg
ctgcttgccgcgccgacgggaagagccgcaaaacggatgagcgaatctacggggctgccg
gctgttacgattcacaggctgctcggctggaatggcgctgaaggctttacctacaatgaa
gatcagccgattgaagggaaactgatcattatagacgaagcgagtatgctcgatatctgg
ctcgccagccatttgtttaaggcgcttcctaagcacattcagctcattgtcgtcggtgat
gaagaccagcttccttcagtaggaccggggcaggtgctcagagaccttttggcttctgag
gtgctgccgaccgtgcgtttgacagatatttaccgtcaggctgaaggatcatccattgtg
gaacttgcgcatgatatgaaaaaaggactgcttccaaaagggctgaccgcgccgacaaag
gaccgctcatttatccgctgtaattcttcacagatgaaagaagtcgtggatcaggtcgtc
tcgaacgcgttaaaaaaggggtatacctccagggatattcaagtgcttgccccgatgtac
aggggaaaagcgggaattaacgagctgaatatgcttcttcaagacatcatgaatccgccg
aaagaaaaaaggcgggagctgaaattcggtgatgtcgtctacaggacgggcgataaaata
ttacagcttgtcaaccagccggaaaacaatgtgtttaatggcgatatcggcgaaatcgtg
tccattttttatgccaaagaaaatacggaaaaagaagacatggtcgtcgtctcgtttgac
ggcaacgaaatcacctttacgaaaaaggatttcagccagtttacccacgcttactgctgt
tccattcataagtcgcagggaagcgaattcccgattgtcgtcctgcctgtcgtcaaaggc
tactatcgaatgctcaggagaaatctgctttataccgccataacaagggcgaaaaaattt
ctgattctttgcggagaagaagaagcgcttgaatggggcgtcaaaaacaatgatgccacc
gtcagacagacgtcgcttaaaaacaggctcacagagcagactgaagagatggatgcagaa
ctggccgccctgcaaaaagagctgccgttcagtgtatatgatgcgaacatcggaatggaa
ggcatcacgccgtttgactttatggaagaaaaagcgtaa

DBGET integrated database retrieval system