KEGG   Bacillus amyloliquefaciens Y2: MUS_3079Help
Entry
MUS_3079          CDS       T02108                                 

Gene name
hemD1
Definition
(GenBank) uroporphyrinogen-III synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
bqy  Bacillus amyloliquefaciens Y2
Pathway
bqy00860  Porphyrin and chlorophyll metabolism
bqy01100  Metabolic pathways
bqy01110  Biosynthesis of secondary metabolites
bqy01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bqy00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    MUS_3079 (hemD1)
Enzymes [BR:bqy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     MUS_3079 (hemD1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4
Motif
Other DBs
NCBI-ProteinID: AFJ62967
UniProt: I2C8J3
Position
complement(2920537..2921316)
Genome map
AA seq 259 aa AA seqDB search
MANDLPLQGKTVLVTRNKRQAAPFRKKVEALGGTAVSASLIAFQEALPDECADSLREDLS
EPGWLVFTSVNGVRFFFSYLDRHGLALSGRKKIAAVGEKTARALKERGARTDAMPDEYVA
ECLADTLKRHASAAEPISVIKGNLSRDVIKAELEPLGYQIREWVLYNTIQDEKGMDELRR
AASRSHFDFITFTSSSAVHTFMHAVGDGEKAWENSGASYISIGPLTEKALLEYGISSHVP
DIYTIEGMLDVMCSMSGKD
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atggcaaatgaccttcctttacaaggaaagaccgtgcttgtcacccggaacaaaagacag
gccgcaccgttccgaaaaaaagtggaggcgctcggcggaacggctgtttccgcttcgctg
atcgcttttcaggaagcgctcccggatgaatgtgcggacagtctccgggaagacctttct
gagccgggatggcttgtgtttacaagcgtaaacggtgtccggttctttttttcctatctt
gatcggcacggtcttgcgctttcgggacggaaaaaaatcgcagccgtcggtgaaaagact
gcgcgcgccctgaaagagcggggagcccggacggatgcgatgcctgacgagtatgtggcg
gaatgtctggctgatactttaaaacggcacgcatcagctgccgaacccatttcagtgata
aagggcaatttatcacgcgatgtcataaaagcggagcttgagccgcttggctatcaaata
agggaatgggtgttatacaataccattcaggatgaaaaaggcatggacgagctgagacgg
gctgcatcccgctctcattttgattttattacgtttaccagctcatcggcggtgcatacg
tttatgcacgcggtcggagacggagaaaaagcgtgggaaaacagcggtgcgagctatatc
agcatcggccctttgacagagaaagcgctcttggaatacgggatctcatcccatgtgcct
gacatctatacgattgaaggcatgctggacgtcatgtgcagcatgtcgggaaaggattga

DBGET integrated database retrieval system