KEGG   Bacillus amyloliquefaciens Y2: MUS_3127Help
Entry
MUS_3127          CDS       T02108                                 

Gene name
ysiB
Definition
enoyl-CoA hydratase (EC:4.2.1.17)
Orthology
K13767  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
bqy  Bacillus amyloliquefaciens Y2
Pathway
Fatty acid degradation
Metabolic pathways
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:bqy00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    MUS_3127 (ysiB)
  Lipid metabolism
   00071 Fatty acid degradation
    MUS_3127 (ysiB)
Enzymes [BR:bqy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     MUS_3127 (ysiB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2970179..2970958)
Genome map
AA seq 259 aa AA seqDB search
MNSLSMAVEQSVAVITINHQPANALSGAVLDELSGLFDRCETDDSVRSIIIRGEGKFFSA
GADIKEFTSLENLEQSSAMADKGQQLMERIEGFPKPVIAAIHGAAFGGGLELAMACHIRI
ATLDAKLGLPELNLGIIPGFAGTQRLPRYVGTAKALEMIGTSEPVTGEEALSLGLVTIGA
EHEEELLQKAKTLAGKFAEKSPQSMASLLELLYSNKIYSYDGGLKLEAKRFGEAFASDDA
KEGIQAFLEKRKPQFGGRR
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgaacagcctttcgatggcggtagaacaatctgttgcggtgatcaccattaatcatcag
ccggccaacgcgctgtccggtgcggttttagatgagttgtccggtctgttcgaccggtgt
gaaacagatgacagcgtcagaagtatcattattcgcggtgagggaaaatttttctcggcg
ggcgccgatataaaggaatttacgtcgcttgaaaatcttgagcaatcttctgccatggcg
gataaaggccagcagctgatggaaagaattgaagggtttccgaagcccgttatcgcagcg
attcacggcgctgcgttcggcggcggtcttgagctagccatggcctgccatatcagaatc
gctacattggatgcaaagctcggcctgcccgagctgaatctcggcattattccgggcttt
gccgggacgcagcggcttccccggtacgtcggtacggcgaaagcgcttgaaatgatcggc
acttcagaacctgtgaccggagaagaagcgctcagcctcggccttgtcacgataggcgcc
gaacatgaggaagagctgctgcaaaaagcgaaaacgctcgcgggcaagtttgcggaaaaa
agcccgcagtcgatggcttctctgcttgagctcctttattcaaacaagatctattcttat
gacggcggcttaaagcttgaagcaaagcgctttggggaagcatttgcatcagatgacgca
aaagaaggcattcaggcatttctcgaaaaaagaaagcctcaattcggtgggcgaagataa

  All links  
No link information was found.   
DBGET integrated database retrieval system