KEGG   Bacillus amyloliquefaciens Y2: MUS_3127Help
Entry
MUS_3127          CDS       T02108                                 

Gene name
ysiB
Definition
(GenBank) enoyl-CoA hydratase
  KO
K13767  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
bqy  Bacillus amyloliquefaciens Y2
Pathway
bqy00071  Fatty acid degradation
bqy00362  Benzoate degradation
bqy01100  Metabolic pathways
bqy01120  Microbial metabolism in diverse environments
bqy01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:bqy00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    MUS_3127 (ysiB)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MUS_3127 (ysiB)
Enzymes [BR:bqy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     MUS_3127 (ysiB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: AFJ63014
UniProt: I2C8P0
Position
complement(2970179..2970958)
Genome map
AA seq 259 aa AA seqDB search
MNSLSMAVEQSVAVITINHQPANALSGAVLDELSGLFDRCETDDSVRSIIIRGEGKFFSA
GADIKEFTSLENLEQSSAMADKGQQLMERIEGFPKPVIAAIHGAAFGGGLELAMACHIRI
ATLDAKLGLPELNLGIIPGFAGTQRLPRYVGTAKALEMIGTSEPVTGEEALSLGLVTIGA
EHEEELLQKAKTLAGKFAEKSPQSMASLLELLYSNKIYSYDGGLKLEAKRFGEAFASDDA
KEGIQAFLEKRKPQFGGRR
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgaacagcctttcgatggcggtagaacaatctgttgcggtgatcaccattaatcatcag
ccggccaacgcgctgtccggtgcggttttagatgagttgtccggtctgttcgaccggtgt
gaaacagatgacagcgtcagaagtatcattattcgcggtgagggaaaatttttctcggcg
ggcgccgatataaaggaatttacgtcgcttgaaaatcttgagcaatcttctgccatggcg
gataaaggccagcagctgatggaaagaattgaagggtttccgaagcccgttatcgcagcg
attcacggcgctgcgttcggcggcggtcttgagctagccatggcctgccatatcagaatc
gctacattggatgcaaagctcggcctgcccgagctgaatctcggcattattccgggcttt
gccgggacgcagcggcttccccggtacgtcggtacggcgaaagcgcttgaaatgatcggc
acttcagaacctgtgaccggagaagaagcgctcagcctcggccttgtcacgataggcgcc
gaacatgaggaagagctgctgcaaaaagcgaaaacgctcgcgggcaagtttgcggaaaaa
agcccgcagtcgatggcttctctgcttgagctcctttattcaaacaagatctattcttat
gacggcggcttaaagcttgaagcaaagcgctttggggaagcatttgcatcagatgacgca
aaagaaggcattcaggcatttctcgaaaaaagaaagcctcaattcggtgggcgaagataa

DBGET integrated database retrieval system