KEGG   Bacillus amyloliquefaciens Y2: MUS_3226Help
Entry
MUS_3226          CDS       T02108                                 

Gene name
ytcI
Definition
(GenBank) acetyl-CoA synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bqy  Bacillus amyloliquefaciens Y2
Pathway
bqy00010  Glycolysis / Gluconeogenesis
bqy00620  Pyruvate metabolism
bqy00640  Propanoate metabolism
bqy00680  Methane metabolism
bqy01100  Metabolic pathways
bqy01110  Biosynthesis of secondary metabolites
bqy01120  Microbial metabolism in diverse environments
bqy01130  Biosynthesis of antibiotics
bqy01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bqy00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MUS_3226 (ytcI)
   00620 Pyruvate metabolism
    MUS_3226 (ytcI)
   00640 Propanoate metabolism
    MUS_3226 (ytcI)
  Energy metabolism
   00680 Methane metabolism
    MUS_3226 (ytcI)
Enzymes [BR:bqy01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     MUS_3226 (ytcI)
Lipid biosynthesis proteins [BR:bqy01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   MUS_3226 (ytcI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C Ribosomal_L6e_N
Motif
Other DBs
NCBI-ProteinID: AFJ63111
UniProt: I2C8Y7
Position
complement(3068345..3069958)
Genome map
AA seq 537 aa AA seqDB search
MGKESEELFVLKREDLIAPKNYNLVNEIEKFSRSKEKNALIWEDQTGGKKVWTYEKLMEE
TNKIGARLKGLGFEKGDKLIVMVPRVLEAYAVYLAILKAGMVVIPCSEMLRAKDLEYRIK
HAEVKGAIVYPSFINAFDEVNTGQLVTLSIGENDAGWKNLLTIEADGDSFQTADTTREDM
AFLSYTSGTTGQPKGVVHTHGWAFAHLKTSAGAWLDISEDDTVWATAAPGWQKWVWSPLL
AILGSGATGVIYHGRFNAKTYLELLERHQVNVFCCTPTEYRLMAKVEELDKYDLSALHSA
VSAGEPLNREVIDVFRKHFGIKVRDGYGQTESTLLVGVLKDMDIKPGSMGKPTPGNQVEI
INDKGEICETGETGDIAVHLSTPALFKEYYKDPERTKKQIRGDYFLTGDRAKKDEDGYFW
FESRNDDIIVSSGYTIGPFEVEDALVKHPEVKECAVVASPDEIRGSIVKAYVVLQDDEKR
SDELVKELQNHVKTITAPYKYPREIEFVESLPKTASAKIRRVELRQREERLKADKKA
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atggggaaagaaagtgaggagttgttcgtgttaaaacgagaagatttaatcgccccaaag
aactataaccttgtaaatgaaatcgaaaagttcagccgttccaaagagaagaacgcgctt
atttgggaagatcaaacaggcggcaagaaagtctggacgtatgaaaaattgatggaagaa
acgaataaaatcggagcccgcctgaaaggtctcggatttgaaaaaggcgataagctgatt
gtcatggttccgagagtgcttgaagcgtatgccgtttatttagcgatcttaaaagcgggg
atggtcgtcattccttgctcggaaatgctgcgcgccaaagaccttgaataccggatcaaa
cacgccgaagtgaaaggcgctatcgtttatccttcatttataaacgcgtttgacgaggtg
aataccgggcagctggtgacattgtcaatcggtgaaaatgatgccggctggaaaaacctc
ctaacgattgaagcggacggagacagttttcaaacagctgatacaacaagagaagatatg
gcgtttttgtcctatacttcaggcacgaccggccagcctaaaggcgttgtacatacacac
ggctgggcctttgcccatttaaaaacatcagccggtgcatggctggatatttctgaagac
gatacagtgtgggccaccgcggcgcccggctggcagaaatgggtgtggagcccgctgctc
gcaattctgggaagcggcgcgacaggagtcatttatcacggcagattcaacgccaagacg
tatttagagctgctggagcgccatcaagtaaatgtcttctgctgtaccccgacggaatac
cgcctgatggcaaaagtggaggagttggacaaatatgatctttctgcccttcacagcgca
gtttctgctggtgagccattaaaccgggaagtcattgacgtattccggaagcatttcggc
attaaagtgagagacggatacggccaaacggagagcaccctgttagtcggcgtcctgaag
gatatggatattaagccgggaagcatgggcaaaccgacccctggaaatcaagtggagatt
ataaacgataaaggcgaaatatgcgaaacgggcgaaacgggcgatatcgccgtgcatttg
agcacaccggccttattcaaggaatattataaagatcccgaaagaacgaaaaagcagatt
cgcggagattactttcttacaggagaccgcgcgaaaaaagacgaggacggctacttttgg
tttgaaagccgcaatgatgacatcatcgtcagctccggatatacaatcgggccttttgaa
gtagaggatgcgctcgtgaagcatccggaagtgaaagaatgtgccgtcgtggcgagcccg
gatgaaatcagaggttcaatcgtaaaagcttatgtcgttttacaagacgatgaaaagcgc
agtgacgaacttgtcaaagaactgcaaaaccacgtaaaaacgattacggcgccttacaaa
tatccgagagaaattgagtttgtcgaaagcctgccgaaaacggcgtccgcaaaaatcaga
cgtgtggagctgagacagcgtgaagaacggctgaaggctgataaaaaagcataa

DBGET integrated database retrieval system