KEGG   Bacillus amyloliquefaciens Y2: MUS_3290Help
Entry
MUS_3290          CDS       T02108                                 

Gene name
ytjP
Definition
succinyl-diaminopimelate desuccinylase (EC:3.5.1.18)
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
bqy  Bacillus amyloliquefaciens Y2
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bqy00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MUS_3290 (ytjP)
  Amino acid metabolism
   00300 Lysine biosynthesis
    MUS_3290 (ytjP)
Enzymes [BR:bqy01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     MUS_3290 (ytjP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3126015..3127490)
Genome map
AA seq 491 aa AA seqDB search
MTNIFSKHHLYYSFYRHFASLYQERGFVMNWEVEVIRNKEDLIRDTQKFLQINSVMDETT
AGPGRPFGEGVNASLTSLLEFGEKEGFTVKNLDGYAGHIEWGTGDEIVGVLCHVDVVPPG
DGWTSDPFSADIRDGRIYARGAIDDKGPTMAAFYALKIVKDMQLPLSKRVRIIIGTDEES
DWRCVDHYFKHEKMPDIGFAPDADFPIINAEKGIIDASLRIAKSASDKDAKNGLLSFRSG
LRLNMVPDAAEAVIEGNGLDAVHAYFSKWLEQSKTQGEAVSENGKLTLRVYGKSCHAMEP
DNGVNAGLKLAECLNGTELDGAGKHFVKTVSDYFSNDTRGKKLKIDCRDDISGELTLNVG
TFTYRKGEEGELGINIRYPVTSDSKVIRDAFTSAEEFRLEEFKDSKPHHVSADHPLVKTL
QKVYEGQTGKKADLISIGGGTYARSLSAGVAFGPLFPGRPDSAHQKDEYIEIDDLLRSTA
LYAEAIYELAK
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgacgaacattttttcaaaacatcatctatattattcgttttatcgacattttgcaagt
ctttatcaagaaaggggatttgtgatgaactgggaagttgaagtcatcagaaacaaagaa
gatctgatccgtgacacgcagaagtttttgcagatcaacagcgtaatggacgaaacaaca
gccggtcccggccggccgtttggagaaggcgtcaatgccagcctgacgtcactgctggaa
ttcggtgaaaaagaaggcttcaccgtaaagaatcttgacggctatgcgggccatattgaa
tggggaacgggtgacgaaatcgtcggcgttctgtgccacgtcgatgtcgttccgcccgga
gacggctggacgagcgatccgttttcagccgatatcagggacggccggatatatgccaga
ggcgccattgatgataaagggccgacaatggcggcgttttatgcgctgaaaatcgtcaaa
gacatgcagcttcctttatccaaacgcgtgagaatcatcatcggaacggatgaagaaagt
gattggagatgcgtggatcactacttcaaacacgaaaaaatgcctgacatcggctttgct
cctgacgcggattttccgatcattaacgcggaaaaaggaattatagatgcgtcactgcgc
attgcaaaaagcgcttctgataaagacgcaaaaaacgggcttctgtccttccgttcagga
ctgcgcttgaacatggtgccggatgcggctgaagcggttattgaagggaacggtcttgat
gccgtgcacgcatatttcagcaaatggcttgagcagtcaaaaacacaaggtgaagcagtt
tcggaaaatggaaaactgacgcttcgggtatacggaaaatcatgccatgcgatggaaccg
gataatggtgtcaatgccggcttaaagcttgctgaatgccttaacggaacggagctggat
ggagccggaaagcactttgtcaaaaccgtcagtgactatttttcaaatgatacacgaggc
aaaaaactgaaaattgattgcagggatgacatcagcggagagcttacattgaatgtcggc
acctttacatacagaaagggtgaggaaggagaactcggcatcaacatccgttatcccgtc
acttcagacagcaaagtcatccgtgatgcttttacgtctgctgaagaattcaggcttgaa
gaatttaaagacagcaaaccgcaccacgtttctgccgatcatccgctcgtaaagacgctt
caaaaggtttacgaaggacagacgggaaagaaagcggatctgatttcaatcggcggagga
acgtatgcgagatccctttcggcgggcgtcgcgttcgggccgctgttccccggccggcct
gacagcgcgcatcaaaaggatgagtacattgaaatcgatgaccttctccggtcaaccgct
ttatacgccgaagccatttatgagcttgccaagtga

DBGET integrated database retrieval system