KEGG   Bacillus amyloliquefaciens Y2: MUS_3525Help
Entry
MUS_3525          CDS       T02108                                 

Gene name
thrC
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
bqy  Bacillus amyloliquefaciens Y2
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:bqy00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MUS_3525 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MUS_3525 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    MUS_3525 (thrC)
Enzymes [BR:bqy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     MUS_3525 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3337458..3338516)
Genome map
AA seq 352 aa AA seqDB search
MWKGLIHQYKEFLPVTDRTPALTLHEGNTPLIHLPKLSEKLGIELHVKTEGVNPTGSFKD
RGMVMAVAKAKEEGNDTIMCASTGNTSAAAAAYAARAGMKCIVIIPDGKIAFGKLAQAVM
YGAEIIAIDGNFDDALAIVRSICEKSPIALVNSVNPYRIEGQKTAAFEVCEQLGGAPDIL
AIPVGNAGNITAYWKGFKEYHEKNGTGLPKMRGFEAEGSAAIVRGEVIKNPETVATAIRI
GNPASWDKAVLAAEESAGKIDEVTDEEILHAYQLIAREEGVFAEPGSCASIAGVLKQVKS
GEIPKGSKVVAVLTGNGLKDPNTAVDVSDIKPITLPTDEDSILEYLNGAARV
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgtggaaaggacttatccatcaatataaagaatttctgccggtgacggatcggacgccg
gccctgacattacatgaaggcaacacgccgctgattcacctgccgaagctttctgaaaag
ctcggaattgaactgcatgtgaaaacagagggcgttaatccgacggggtcctttaaggac
cgcggcatggtcatggcggtcgccaaagcgaaagaagaaggcaatgataccatcatgtgc
gcctctacaggcaacacatccgccgcggctgcggcatacgcggcgagagccggcatgaaa
tgcatcgtcatcatcccggacggaaaaatcgccttcggaaaacttgcgcaggccgtcatg
tacggtgcggaaatcattgcgattgacggaaactttgacgacgcgctggccatcgtccgg
tcaatttgcgaaaaatcaccgattgcattagtgaattcagtaaacccttaccggattgaa
gggcaaaaaacagcggcctttgaagtatgcgaacagctcggcggagcgccggacattctg
gcgatcccggtaggaaacgccgggaatatcacggcctactggaaagggttcaaagaatac
catgagaaaaacggcaccggacttccgaagatgcgcggttttgaggcggaaggttctgcg
gctatcgtccgcggcgaagtcattaaaaatccagagaccgttgcgacggcaatccgaatc
gggaatcctgccagctgggacaaagcggtgctcgctgcggaagaatcagccggaaaaatt
gatgaagtcacagatgaagaaattcttcacgcttatcagctgattgcccgtgaagaaggc
gtgtttgccgaaccgggctcctgtgcatccatcgccggcgttttgaaacaggtgaaatcc
ggtgaaattccaaaaggcagcaaggttgtcgcagttttgaccggaaacggcctgaaagat
ccgaacacggctgtggacgtttctgacataaaaccgattacgctgccgacagatgaggac
agtattctggaatacttaaatggagcggcgcgtgtatga

DBGET integrated database retrieval system