KEGG   Bacillus amyloliquefaciens Y2: MUS_3689Help
Entry
MUS_3689          CDS       T02108                                 

Gene name
yvaK
Definition
carboxylesterase (EC:3.1.1.1)
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
bqy  Bacillus amyloliquefaciens Y2
Brite
Enzymes [BR:bqy01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     MUS_3689 (yvaK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3484939..3485703)
Genome map
AA seq 254 aa AA seqDB search
MCKKGVMSMKIVTPKPFTFKGGDKAVLLLHGFTGNTADVRMLGRYLNERGYTCHAPQYKG
HGVPPEELVHTGPEDWWKDVMDGYEYLRSEGYENIAACGLSLGGVFSLKLGYTVPIKGIV
PMCAPMHIKSEEVMYEGVLSYARNYKKFEGKQPEQIEKEMKEFEKTPMNTLKSLQELIAD
VRKNVDMIYSPTFVVQARHDHMINTESANIIYNEVETDDKQLKWYEESGHVITLDKERDL
VHQDVYEFLEKLDW
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgtgcaaaaaaggggttatgagcatgaaaattgtgacaccaaaaccatttacatttaaa
ggcggagacaaagcggtgcttctgctgcacggatttacgggaaatacggcagacgtcaga
atgctcggccgctacttgaatgagcgcggctacacttgtcacgcgcctcaatataaaggg
cacggcgttccgccggaagagctggtacatacggggcctgaagattggtggaaagacgtc
atggacggttatgaatatttacggtctgaaggctatgaaaacattgcggcctgcggactg
tcgcttggcggggttttttcattgaaattgggttacactgtacccataaagggaattgtt
cctatgtgtgcgccgatgcacattaaaagtgaagaggttatgtacgaaggagttctttcc
tacgcgcgcaattataaaaaattcgaaggaaaacagccggagcagattgaaaaggaaatg
aaggagtttgaaaaaacaccgatgaatacgctcaaatcgcttcaggagctgattgccgat
gtgcgcaaaaacgtcgacatgatctattccccgacatttgtggttcaggcacggcatgac
catatgattaatacagaaagtgcgaacatcatttacaacgaggtggaaacggacgacaaa
cagctgaaatggtatgaagaatcaggccatgtcattacgctcgataaagaacgggacctc
gttcatcaggatgtgtacgaatttttagagaaactcgattggtaa

DBGET integrated database retrieval system