KEGG   Bacillus amyloliquefaciens Y2: MUS_3722Help
Entry
MUS_3722          CDS       T02108                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bqy  Bacillus amyloliquefaciens Y2
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bqy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MUS_3722 (tpiA)
   01230 Biosynthesis of amino acids
    MUS_3722 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MUS_3722 (tpiA)
   00051 Fructose and mannose metabolism
    MUS_3722 (tpiA)
   00562 Inositol phosphate metabolism
    MUS_3722 (tpiA)
Enzymes [BR:bqy01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     MUS_3722 (tpiA)
Exosome [BR:bqy04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   MUS_3722 (tpiA)
  Exosomal proteins of bladder cancer cells
   MUS_3722 (tpiA)
  Exosomal proteins of melanoma cells
   MUS_3722 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3507941..3508711)
Genome map
AA seq 256 aa AA seqDB search
MEQMRKPIIAGNWKMNKTLGEAVSFVEEVKSSIPAADKAEAVVCAPALFLEKLTSAVKGT
DLKVGAQNMHFEENGAFTGEISPVALKDLGVDYCVIGHSERREMFAETDETVNKKAHAAF
KHGIVPIICVGETLEEREAGKTNDLVADQVKKGLAGLSEEQVAASVIAYEPIWAIGTGKS
STAKDANDVCAHIRKVVAESFSQETADKLRIQYGGSVKPANIKEYMAESDIDGALVGGAS
LEPQSFVQLLEEGQYE
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
gtggaacagatgagaaaaccaattatagccggtaactggaaaatgaacaaaacactcggc
gaagctgtcagcttcgttgaagaagtgaaatcttccattccagcagcagacaaagcggaa
gccgttgtttgcgcaccagctcttttcttagaaaagctgacttctgctgttaaaggaact
gacctgaaagtcggcgcccaaaacatgcattttgaagaaaacggtgcgttcacaggtgaa
atcagcccggtcgctctgaaagaccttggcgtggattactgcgtcatcggccactctgag
cgccgtgaaatgttcgctgaaactgatgaaacagttaacaaaaaagcgcatgccgctttc
aaacacggcattgtgccgatcatttgcgtaggtgaaacgcttgaagagcgcgaagccgga
aaaacaaatgatcttgttgccgatcaagtgaaaaaaggtcttgcgggtctttctgaagag
caagttgccgcttccgttattgcgtacgagccaatctgggcaatcggaacaggcaaatct
tctacagcgaaagatgctaacgacgtctgcgcgcatatccgtaaagtcgttgctgaaagc
ttcagccaggaaactgctgacaagctccgcattcaatacggcggcagcgtaaaacctgca
aatattaaagaatatatggcagagtccgatattgacggtgctttggtcggcggcgcaagc
cttgaaccgcagtcattcgttcaattattggaggaaggtcaatatgagtaa

DBGET integrated database retrieval system