KEGG   Bacillus amyloliquefaciens Y2: MUS_3910Help
Entry
MUS_3910          CDS       T02108                                 

Gene name
gtaB
Definition
UTP--glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bqy  Bacillus amyloliquefaciens Y2
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bqy00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    MUS_3910 (gtaB)
   00052 Galactose metabolism
    MUS_3910 (gtaB)
   00500 Starch and sucrose metabolism
    MUS_3910 (gtaB)
   00520 Amino sugar and nucleotide sugar metabolism
    MUS_3910 (gtaB)
Enzymes [BR:bqy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     MUS_3910 (gtaB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3709343..3710227
Genome map
AA seq 294 aa AA seqDB search
MKKVRKAIIPAAGLGTRFLPATKAMPKEMLPIVDKPTIQYIIEEAVESGIEDIIIVTGKG
KRAIEDHFDNAPELERNLEEKGKIELLQKVKKSSNIADIHYIRQKEPKGLGHAVWCARNF
IGDEPFAVLLGDDIVQAEKPGLRQLMDEYEKTLSSIIGVQQVPESDTHRYGIIDPLTNEG
RRYQVKNFVEKPEPGTAPSNLAILGRYVFTPEIFMYLEQQEVGAGGEIQLTDAIQKLNDI
QRVFAYDFEGKRYDVGEKLGFIETTLEFALQDQDIRHKLIPFMKDLLEKEEADE
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
gtgaagaaagtacgcaaagccattattccggcagcaggtttaggcactcgttttttgccg
gccactaaagcaatgcctaaagaaatgcttccaatcgttgataagcctacaattcagtat
attatcgaagaagctgtcgaatccggcatcgaagatattattatcgtaaccggaaaagga
aaaagagcaatagaagaccatttcgacaatgcccctgaactggaacgtaatttagaagaa
aaagggaaaatcgaactgcttcaaaaagtgaaaaaatcgtcaaatattgcggatatccac
tatattcgccaaaaagagccaaaaggactcggtcatgccgtttggtgcgcacgcaacttc
atcggcgatgaacctttcgccgttcttctcggcgatgatattgtccaggctgaaaaaccg
ggacttcgtcagctgatggatgaatacgaaaaaacattgtcttcaatcatcggtgttcag
caagttcctgaaagcgacacacaccgctacggaattatcgatccgttaacaaatgaaggc
cgccgttaccaggtcaaaaattttgtagagaagcctgaaccgggcacagctccttccaac
ttggctattttaggaagatacgttttcactcctgaaattttcatgtacctggaacagcag
gaagtcggtgcaggaggagaaattcaattaacggacgccatccaaaagctcaatgacatt
cagcgtgtcttcgcttatgatttcgaaggaaaacgttacgatgtcggtgaaaaactcgga
tttatcgagacgacgcttgaatttgccttacaggatcaggatatccgccataaattgatt
ccgttcatgaaggatcttcttgaaaaagaagaagctgacgaatag

DBGET integrated database retrieval system