KEGG   Bacillus amyloliquefaciens Y2: MUS_4119Help
Entry
MUS_4119          CDS       T02108                                 

Gene name
speB
Definition
agmatinase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
bqy  Bacillus amyloliquefaciens Y2
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:bqy00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3876654..3877526)
Genome map
AA seq 290 aa AA seqDB search
MRFDEAYSGKVFIASRPDWKEADAILYGMPMDWTVSYRPGSRFGPGRIREVSIGLEEYSP
YLDRDLADLNFFDAGDIPLPFGNPQRSLDMIEEYVDSILEKGKFPLGMGGEHLVSWPVIK
AMYKKFPDLAIIHFDAHTDLRTDYEGEPLSHSTPIRKAAELIGPQNVFSFGIRSGMKEEF
EWAKENGMHISKFEVLEPLKKVLPQLAGRPVYVTIDIDVLDPAHAPGTGTVDAGGITSKE
LLASIHEIARSEVNVKGADLVEVAPVYDHSEQTANTASKMIREMLLGFVK
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgaggtttgatgaagcatattcaggaaaagtatttatcgcaagccgccccgactggaaa
gaggcggacgccatcctttacggcatgccgatggattggacggtcagctaccgtccgggt
tcgcgtttcggcccggggagaatccgcgaggtgtctatcggtcttgaagaatacagcccg
tatctcgaccgtgacttggctgatttgaatttctttgacgccggcgatattccgcttccg
ttcggcaatccgcaaagaagccttgatatgattgaagaatacgtggacagcattttagaa
aaaggaaagttcccgctcggcatgggaggggagcaccttgtatcatggcctgtcataaaa
gccatgtataagaaatttccggaccttgccatcattcattttgacgcgcacaccgacctg
cgcacggattatgaaggcgaaccgctttcccactctactccgatccgcaaagcggccgag
ctcatcgggccgcaaaacgtattttcattcggcatccgttccggaatgaaggaagaattt
gaatgggcgaaagaaaacggcatgcacatttctaagtttgaagtgcttgagccgctgaaa
aaagtgctgccgcagcttgcgggacgccctgtttatgtcacgatcgatatcgacgtgctt
gaccccgctcatgcgccgggaacgggcacggttgacgcaggaggcatcacgtctaaagaa
ttgctcgcgtccatccatgaaatcgcacgctcagaagtcaacgtaaaaggcgccgacctc
gtagaagtcgcgccggtctatgaccactcagaacaaaccgcaaacacggcaagcaagatg
attcgtgaaatgctgcttgggtttgtgaaataa

DBGET integrated database retrieval system