KEGG   Bradyrhizobium sp. ORS 278: BRADO0074Help
Entry
BRADO0074         CDS       T00516                                 

Gene name
mutM
Definition
formamidopyrimidine-DNA glycosylase (EC:3.2.2.23 4.2.99.18)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
bra  Bradyrhizobium sp. ORS 278
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:bra03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(83514..84395)
Genome map
AA seq 293 aa AA seqDB search
MPELPEVETVRRGLQPVMEGAKIVTAEARRGDLRFPFQPDFVKRLQGQTVRGLGRRAKYL
LADLGSGDVLLMHLGMSGSFRVIKPEHEETPGEFHYPRGKDSVHDHVVFHMSSGADIVFN
DPRRFGFMKIIGRGEIETEPHLKDLGPEPLGNEFDAAMLARACAGKKTSLKAALLDQRVV
AGLGNIYVCEALFRAHLSPRRLAATLATRKGEPTDHAKRLVEAIHTVLNEAIRAGGSSLR
DHRQTTGELGYFQHSFQVYDREGEPCRTDGCEGVVKRFVQNGRSTFWCPKCQR
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaactgcccgaagtcgagaccgtccggcgcgggctgcagccggtcatggaggga
gccaagatcgtgaccgcggaggcgcggcgcggcgacttgcggtttccgtttcaacccgat
tttgtgaagcgcttgcaggggcagaccgtcagagggctcggccgccgcgccaaatatctg
ctggccgatctcggctccggcgacgtgctgctgatgcatctgggcatgtccggctcgttc
cgggtgatcaagcccgagcacgaggaaaccccgggcgagtttcactatccgcgcggcaag
gacagcgtccacgaccatgtcgtgtttcacatgtcttccggcgccgacatcgttttcaac
gacccgcgccgcttcggcttcatgaagatcatcggccgcggcgagatcgagaccgagccg
cacctcaaggacctcgggccggagccgctcggcaacgaattcgatgccgccatgctggcg
cgcgcctgtgccggcaagaagaccagcctcaaggccgcgttgctcgaccagcgcgtggtc
gccgggctcggcaacatctatgtctgcgaggcgctgttccgcgcgcatctgtcgccgcgc
cgtctggccgcgacgctggcgaccaggaagggcgagccgacggaccatgcaaagcggctg
gttgaggcgatccacaccgtgctcaacgaggcgatccgcgccggcggctcgtcgctgcgc
gatcaccgccagaccactggcgagctcggctatttccagcactcgttccaggtctatgac
cgagagggcgagccgtgccgcacggatggctgcgagggcgtcgtcaagcgcttcgtgcag
aacggacgatcgacgttctggtgcccgaagtgtcagagatga

DBGET integrated database retrieval system