KEGG   Bradyrhizobium sp. ORS 278: BRADO0090Help
Entry
BRADO0090         CDS       T00516                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
bra  Bradyrhizobium sp. ORS 278
Pathway
bra00260  Glycine, serine and threonine metabolism
bra00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bra01100  Metabolic pathways
bra01110  Biosynthesis of secondary metabolites
bra01130  Biosynthesis of antibiotics
bra01230  Biosynthesis of amino acids
Module
bra_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bra00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BRADO0090 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BRADO0090 (trpA)
Enzymes [BR:bra01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BRADO0090 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth PcrB Pterin_bind
Motif
Other DBs
NCBI-ProteinID: CAL74061
RhizoBase: BRADO0090
UniProt: A4YJI5
Position
complement(106668..107504)
Genome map
AA seq 278 aa AA seqDB search
MTSRMDARFAQLKSEGRSAFVTFVMGGDPDPETSLAIVKALPQAGADIIEIGMPFTDPMA
DGPSIQAAGLRALKAGMTLRKTLQLVRSFREGDAATPIVLMGYYNPIYIYGVDKFLDDAK
SAGVDGLIIVDLPPEEDDELCIPALKAGLNFIRLATPTTDDKRLPAVLANTSGFVYYVSI
TGITGAAAADSSAVGSAVARIKRHTALPVCVGFGIRTPETARAIAAHADGAVVGTALVDA
LKASLDAEGRATAKTVNAVADLAAALAQGVRGAQQAAE
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
gtgaccagccggatggatgcgcgcttcgcgcagttaaagagtgaaggccgttcggcattc
gtgacgttcgtgatgggcggcgaccccgatccggagacgtcgctcgcgatcgtcaaggcg
ctgccgcaggcgggcgccgacatcatcgagatcggcatgccgttcaccgatccgatggcc
gacggcccgtcgatccaggccgcgggcctgcgcgcgctgaaagcgggcatgaccctgagg
aagacgctgcagctggtgcgcagtttccgcgagggcgacgcagccacgccgatcgtgctg
atgggctactacaacccgatctacatctatggcgtcgacaagttcctcgacgacgccaag
agcgccggtgtcgacggcctgatcatcgtcgacctgccgccggaagaagacgacgagctg
tgcattccggcgctcaaggccgggctcaacttcatccgtctggcgaccccgaccaccgat
gacaagcggctgccggccgtgctcgcgaacacctccggcttcgtctactacgtctcgatc
accggcatcaccggtgcggccgcggccgactcctccgccgtcgggtcggccgttgcgcga
atcaagcgccacacggcgctgccggtctgcgtcggtttcggcattcggacaccggaaacc
gcccgggctatcgccgcccacgctgacggcgccgtggtcggcaccgccctggtggatgcc
ctgaaggcgagcctggacgccgagggccgggcgacggccaagaccgtcaacgcggtcgcc
gaccttgccgccgccctcgcccagggcgtgcggggcgcccagcaggccgcggaatag

DBGET integrated database retrieval system