KEGG   Bradyrhizobium sp. ORS 278: BRADO0090Help
Entry
BRADO0090         CDS       T00516                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
bra  Bradyrhizobium sp. ORS 278
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bra00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BRADO0090 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BRADO0090 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BRADO0090 (trpA)
Enzymes [BR:bra01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BRADO0090 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(106668..107504)
Genome map
AA seq 278 aa AA seqDB search
MTSRMDARFAQLKSEGRSAFVTFVMGGDPDPETSLAIVKALPQAGADIIEIGMPFTDPMA
DGPSIQAAGLRALKAGMTLRKTLQLVRSFREGDAATPIVLMGYYNPIYIYGVDKFLDDAK
SAGVDGLIIVDLPPEEDDELCIPALKAGLNFIRLATPTTDDKRLPAVLANTSGFVYYVSI
TGITGAAAADSSAVGSAVARIKRHTALPVCVGFGIRTPETARAIAAHADGAVVGTALVDA
LKASLDAEGRATAKTVNAVADLAAALAQGVRGAQQAAE
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
gtgaccagccggatggatgcgcgcttcgcgcagttaaagagtgaaggccgttcggcattc
gtgacgttcgtgatgggcggcgaccccgatccggagacgtcgctcgcgatcgtcaaggcg
ctgccgcaggcgggcgccgacatcatcgagatcggcatgccgttcaccgatccgatggcc
gacggcccgtcgatccaggccgcgggcctgcgcgcgctgaaagcgggcatgaccctgagg
aagacgctgcagctggtgcgcagtttccgcgagggcgacgcagccacgccgatcgtgctg
atgggctactacaacccgatctacatctatggcgtcgacaagttcctcgacgacgccaag
agcgccggtgtcgacggcctgatcatcgtcgacctgccgccggaagaagacgacgagctg
tgcattccggcgctcaaggccgggctcaacttcatccgtctggcgaccccgaccaccgat
gacaagcggctgccggccgtgctcgcgaacacctccggcttcgtctactacgtctcgatc
accggcatcaccggtgcggccgcggccgactcctccgccgtcgggtcggccgttgcgcga
atcaagcgccacacggcgctgccggtctgcgtcggtttcggcattcggacaccggaaacc
gcccgggctatcgccgcccacgctgacggcgccgtggtcggcaccgccctggtggatgcc
ctgaaggcgagcctggacgccgagggccgggcgacggccaagaccgtcaacgcggtcgcc
gaccttgccgccgccctcgcccagggcgtgcggggcgcccagcaggccgcggaatag

DBGET integrated database retrieval system