KEGG   Bradyrhizobium sp. ORS 278: BRADO0091Help
Entry
BRADO0091         CDS       T00516                                 

Gene name
trpB
Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
bra  Bradyrhizobium sp. ORS 278
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bra00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BRADO0091 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BRADO0091 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BRADO0091 (trpB)
Enzymes [BR:bra01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BRADO0091 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(107501..108724)
Genome map
AA seq 407 aa AA seqDB search
MTTAIPNSYRSGPDERGHFGIFGGRFVAETLMPLILDLEKAYADAKADPAFQGEMNSYRT
HYVGRPSPLYYAERLTEHLGGAKIYFKRDELNHTGSHKVNNVLGQIMLARRMGKKRIIAE
TGAGQHGVATATLCARFGLDCVVYMGAVDVERQQPNVLRMEMLGAKVIPVQSGARTLKDA
MNEALRDWVTNVHNTFYCIGTVAGPHPYPMMVRDFQSVIGQETRTQMQEAEGRLPDSLVA
CIGGGSNAMGLFHPFLDDPSVEIFGVEAAGHGLTQLHAASIAGGRPGVLHGNRTYLLMDD
DGQIAEAHSISAGLDYPGIGPEHSWLHEAKRVTYLSATDDEALDAFLLLSRLEGIIPALE
PAHAVAKVMQLAPNKPKDHLMVVNLCGRGDKDVPQVGEILRKRAKQS
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgacgacagccattcccaattcctaccgcagcggtccggacgagcgcggccatttcggc
atcttcggtggccgcttcgtggccgagaccctgatgccgctgatcctggatctcgaaaag
gcctatgccgacgccaaggctgatccggcattccagggcgagatgaacagttaccggacg
cattacgtcggccgtccatcgccgctgtactatgccgagcgtctgaccgagcatctcggc
ggcgccaagatctatttcaagcgcgacgagctcaatcataccggctcgcacaaggtcaac
aacgtgctcggccagatcatgctggcgcgccggatgggcaagaagcgcatcatcgccgag
accggcgctggtcagcatggcgtcgccaccgcgacgctgtgcgcgcgcttcgggctggac
tgcgtggtctatatgggcgccgtcgacgtggagcggcagcagccgaacgtgctgcgcatg
gagatgctgggcgccaaggtcattccggtgcagtccggcgccaggacgctgaaggatgcg
atgaacgaggcgctgcgtgactgggtcaccaacgtccacaacacattttattgcatcggc
acggtggccggcccgcatccctatcccatgatggtgcgcgacttccagtcggtgatcggc
caggagacgcggacgcagatgcaggaggccgagggccggctgccggattcgctcgtggcc
tgcatcggcggcggctccaatgcgatgggcctgtttcatcccttcctcgatgatccctcc
gtcgagatcttcggcgtcgaggccgcgggccacggcctgacgcagctgcatgcggcgtcg
atcgcgggtggccgtccaggtgtgctgcatggcaaccggacctatctgctgatggacgac
gacggccagatcgccgaggcgcattcgatctcggccggcctcgactatcccggcatcggt
cctgagcattcctggctgcacgaggccaagcgcgtgacctatctgtccgcgaccgacgac
gaggcgctggacgcgttcctgctgctgtcccggttggagggcatcatcccggcgctcgag
ccggcgcacgcggtggccaaggtgatgcagctcgcgccgaacaagccgaaggaccatttg
atggtcgtcaatctgtgcggccgcggcgacaaggacgtgccgcaggtcggcgagatcctg
cgtaagagggcgaaacagtcgtga

DBGET integrated database retrieval system