KEGG   Bradyrhizobium sp. ORS 278: BRADO0233Help
Entry
BRADO0233         CDS       T00516                                 

Gene name
sdhD
Definition
(GenBank) Succinate dehydrogenase hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
bra  Bradyrhizobium sp. ORS 278
Pathway
bra00020  Citrate cycle (TCA cycle)
bra00190  Oxidative phosphorylation
bra00650  Butanoate metabolism
bra01100  Metabolic pathways
bra01110  Biosynthesis of secondary metabolites
bra01120  Microbial metabolism in diverse environments
bra01130  Biosynthesis of antibiotics
bra01200  Carbon metabolism
Module
bra_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bra_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
bra_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:bra00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BRADO0233 (sdhD)
   00650 Butanoate metabolism
    BRADO0233 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    BRADO0233 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS
Motif
Other DBs
NCBI-ProteinID: CAL74196
RhizoBase: BRADO0233
UniProt: A4YJX0
Position
248752..249126
Genome map
AA seq 124 aa AA seqDB search
MRTPLGRVRNLGAAHSGTGDFWRQRITAVAMTLLIVPVVVVVIMLLGRNQAGAAQILGSL
PIALIMLLFVVASCWHMKIGMQVIIEDYVHTESLKLIAIMGNNFFAVTVAIASIYALIKL
STGV
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atgcggaccccgctgggccgcgtccgcaacctcggtgcggctcactccggcacgggagac
ttctggcgtcagcgcatcaccgcggtcgcgatgaccctgctgatcgtgccggtcgtcgtc
gtcgtcatcatgctgctcggccgcaaccaggccggtgctgcgcagatcctcggctcgctg
ccgatcgcgctgatcatgctgctgttcgtggtcgccagctgctggcacatgaagatcggc
atgcaggtgatcatcgaggactacgtgcacaccgagtcgctcaaactcatcgcgatcatg
ggcaacaacttctttgccgtgaccgtggcgatcgcctcgatctacgccctcatcaaactg
tccactggagtctag

DBGET integrated database retrieval system