KEGG   Bradyrhizobium sp. ORS 278: BRADO0250Help
Entry
BRADO0250         CDS       T00516                                 

Definition
quinone oxidoreductases (NADPH) and Zn-dependent alcohol dehydrogenases (EC:1.1.1.1 1.6.5.5)
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
K00344  
NADPH2:quinone reductase [EC:1.6.5.5]
Organism
bra  Bradyrhizobium sp. ORS 278
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bra00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    BRADO0250
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BRADO0250
  Lipid metabolism
   00071 Fatty acid degradation
    BRADO0250
  Amino acid metabolism
   00350 Tyrosine metabolism
    BRADO0250
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BRADO0250
   00626 Naphthalene degradation
    BRADO0250
Enzymes [BR:bra01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BRADO0250
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.5  NADPH:quinone reductase
     BRADO0250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
265947..266921
Genome map
AA seq 324 aa AA seqDB search
MKAILCSQFCQPDDLVLAEVPDPVAGPGEAVIAIKAAALNFFDILMIQGKYQIKPPFPFS
PGAEVAGIIESVGDGVTDLKVGDRVVASCGHNGAREKIALPAAAIVKIPDHLDFDRAAGI
IIIYGTALHALEDRASPKPGETLAVLGAAGGTGLAACELGQLMGLKVIACASSDEKLAFA
KQHGATLTLNYAKDDLKEGLRRLTDGKGADIIFDPVGGTYAEAALRSIAWEGRFLVIGFA
AGDIPKMPLNLALLKGCDIRGVFWGAWTRLNPAKNRANLEKLVQWTADGKLSSHVDRTFP
LAQTADALKVLAGRQAMGKVILHP
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagccattctctgctcgcaattctgtcagcccgacgatctcgttcttgccgaggtg
cccgatccggtggccggacccggcgaggccgtgattgcgatcaaagcggcggcgctgaac
ttcttcgacatcctgatgatccagggcaagtaccagatcaagccgccgttcccgttctcg
ccgggtgcggaggtcgcgggaatcatcgagagcgttggcgacggcgtgacggatctcaag
gtcggcgatcgcgtcgtcgcgtcctgcggtcataacggcgcgcgcgagaagatcgcgctg
ccggctgccgcgatcgtcaagattcccgatcatctcgactttgatcgagccgccggcatc
atcatcatctacggcacggcgctacatgcgctcgaggaccgcgccagccccaagcccggc
gagacgctggccgtgctcggtgcggccggcggcaccggcctcgcggcctgcgagctcggc
cagctgatggggctgaaggtgatcgcctgcgcctcctcggacgagaagcttgcattcgcg
aagcaacacggtgcgacgctgaccttgaactacgcgaaagacgatctgaaggaaggcctg
cgccggctgaccgacggcaagggcgccgacatcatcttcgatcccgtcggcggcacctat
gccgaggccgcgttgcgctcgatcgcatgggagggccgcttcctggtgatcggctttgcc
gcgggcgatattccgaagatgccgctcaacctggcgctgctgaagggctgtgacatccgc
ggcgtgttctggggcgcctggacccggctcaacccggccaagaaccgcgccaatctcgag
aagctcgtgcagtggaccgccgacggcaagctgtcgtcgcatgtcgaccgcaccttcccg
ctcgcgcagaccgccgatgcgctcaaggtgctggccggccggcaggccatgggcaaggtg
atcctgcacccttga

DBGET integrated database retrieval system