KEGG   Bradyrhizobium sp. ORS 278: BRADO0283Help
Entry
BRADO0283         CDS       T00516                                 

Definition
cytochrome P450 hydroxylase superfamily proteins (EC:1.14.14.1)
Orthology
K00493  
unspecific monooxygenase [EC:1.14.14.1]
Organism
bra  Bradyrhizobium sp. ORS 278
Pathway
Fatty acid degradation
Tryptophan metabolism
Aminobenzoate degradation
Microbial metabolism in diverse environments
Class
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:bra00071]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:bra00380]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:bra00627]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(295604..296980)
Genome map
AA seq 458 aa AA seqDB search
MSTADVHYLPRSPLVPPMPPRAPDSMGALRRVLMMGENAISTWSQRAYEDEIVHGRFFGS
SSYILNTPETIKHVLVDNWENYARTVGAIRVLRPVLGEGLLIAEGKAWKHQRRTLAPAFT
PRAVSGLIPHMVAVTEETVARLQQQCGQPLDLREIMQRMTLDIAGRTMFSFEMGRHGATL
RDFVFEYGERLASPHLLDIVLPLSWPTPRDFARRRFRKRWTDFVGMLMAERRAAGKREDA
PPRDLFDLMGAARDPETGAAFTDAQLADEVATMILAGHETTATALFWALYLIALDPANQE
KLAQEAQAATDLSNPDLLPFTRAVMDETVRLYPPAFLIARAASGPDQIAAFEVKRGDVVL
ISPWLLHRHERLWRSPNAFMPERFLPGAPPPERFAYLPFGAGARVCIGAHFALVEAVLAL
ARLVAAFRIELVDPAPVMPVGVVTTQPDRSPLFRITPR
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccgccgacgtccactatctgccccgatcgcccctggttccgccgatgccgcca
cgcgcgccggacagcatgggcgcgctgcgccgcgtgctgatgatgggcgagaatgcgatc
tcgacctggagccagcgcgcctacgaggacgagatcgtccacggccgcttcttcggcagc
tcgagctacatcctgaacacgcccgagaccatcaagcatgtgctggtcgacaattgggag
aactatgcccgtaccgtcggcgccatccgcgtgctgcggccggtgctcggcgaaggcctg
ctgatcgccgagggcaaggcatggaagcaccagcgccgcaccctggcgccggcgttcacg
ccgcgcgcggtctcgggcctgattccgcacatggtcgcggtgaccgaggagaccgtcgcc
cggctgcagcagcaatgcggccagccgctcgatctgcgcgagatcatgcagcggatgacg
ctcgacatcgcgggccgaacgatgttctcgttcgagatgggccgccatggcgcgaccttg
cgcgatttcgtgttcgaatatggcgagcggctggcaagtccgcatctgctcgacatcgtg
ctgccgctgtcctggccgacgccgcgcgattttgcgcgacgtcgcttccgcaagcgctgg
accgacttcgtcggcatgttgatggccgagcgccgcgccgccggcaagcgcgaggacgcg
ccgccgcgcgacctgttcgatttgatgggcgcggcgcgcgatccggaaaccggcgcggcg
ttcaccgacgcgcagctcgccgacgaggtcgcgaccatgatcctcgccggccacgagacc
acggccaccgcgctgttctgggcgctgtatctgatcgcgctcgacccggccaaccaggag
aagctggcgcaggaggcgcaggccgcgaccgatctcagcaatccggatctgctgccgttc
acccgcgccgtgatggacgagacggtgcggctgtatccgccggccttcctgatcgcgcgc
gcggccagcggccctgaccagatcgccgcattcgaggtcaagcgcggcgacgtggtcctg
atctcgccctggctcctgcaccggcacgagcggctgtggcggtcgcccaacgccttcatg
cccgagcgattcctgccgggcgcgccgccaccggagcggttcgcctatctgccgttcggc
gccggcgcccgcgtctgcatcggggctcatttcgcgctcgtcgaagcggtgctggcgctg
gcgcgcctggttgccgccttccggatcgagctggtcgatcccgcgccggtcatgccggtc
ggcgtggtgacgacgcagcccgaccgttcaccactgttcaggatcacgccgcgctga

DBGET integrated database retrieval system