KEGG   Bradyrhizobium sp. ORS 278: BRADO0283Help
Entry
BRADO0283         CDS       T00516                                 

Definition
cytochrome P450 hydroxylase superfamily proteins (EC:1.14.14.1)
Orthology
K00493  
unspecific monooxygenase [EC:1.14.14.1]
Organism
bra  Bradyrhizobium sp. ORS 278
Pathway
Fatty acid degradation
Tryptophan metabolism
Aminobenzoate degradation
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bra00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    BRADO0283
  Amino acid metabolism
   00380 Tryptophan metabolism
    BRADO0283
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    BRADO0283
Enzymes [BR:bra01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     BRADO0283
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(295604..296980)
Genome map
AA seq 458 aa AA seqDB search
MSTADVHYLPRSPLVPPMPPRAPDSMGALRRVLMMGENAISTWSQRAYEDEIVHGRFFGS
SSYILNTPETIKHVLVDNWENYARTVGAIRVLRPVLGEGLLIAEGKAWKHQRRTLAPAFT
PRAVSGLIPHMVAVTEETVARLQQQCGQPLDLREIMQRMTLDIAGRTMFSFEMGRHGATL
RDFVFEYGERLASPHLLDIVLPLSWPTPRDFARRRFRKRWTDFVGMLMAERRAAGKREDA
PPRDLFDLMGAARDPETGAAFTDAQLADEVATMILAGHETTATALFWALYLIALDPANQE
KLAQEAQAATDLSNPDLLPFTRAVMDETVRLYPPAFLIARAASGPDQIAAFEVKRGDVVL
ISPWLLHRHERLWRSPNAFMPERFLPGAPPPERFAYLPFGAGARVCIGAHFALVEAVLAL
ARLVAAFRIELVDPAPVMPVGVVTTQPDRSPLFRITPR
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccgccgacgtccactatctgccccgatcgcccctggttccgccgatgccgcca
cgcgcgccggacagcatgggcgcgctgcgccgcgtgctgatgatgggcgagaatgcgatc
tcgacctggagccagcgcgcctacgaggacgagatcgtccacggccgcttcttcggcagc
tcgagctacatcctgaacacgcccgagaccatcaagcatgtgctggtcgacaattgggag
aactatgcccgtaccgtcggcgccatccgcgtgctgcggccggtgctcggcgaaggcctg
ctgatcgccgagggcaaggcatggaagcaccagcgccgcaccctggcgccggcgttcacg
ccgcgcgcggtctcgggcctgattccgcacatggtcgcggtgaccgaggagaccgtcgcc
cggctgcagcagcaatgcggccagccgctcgatctgcgcgagatcatgcagcggatgacg
ctcgacatcgcgggccgaacgatgttctcgttcgagatgggccgccatggcgcgaccttg
cgcgatttcgtgttcgaatatggcgagcggctggcaagtccgcatctgctcgacatcgtg
ctgccgctgtcctggccgacgccgcgcgattttgcgcgacgtcgcttccgcaagcgctgg
accgacttcgtcggcatgttgatggccgagcgccgcgccgccggcaagcgcgaggacgcg
ccgccgcgcgacctgttcgatttgatgggcgcggcgcgcgatccggaaaccggcgcggcg
ttcaccgacgcgcagctcgccgacgaggtcgcgaccatgatcctcgccggccacgagacc
acggccaccgcgctgttctgggcgctgtatctgatcgcgctcgacccggccaaccaggag
aagctggcgcaggaggcgcaggccgcgaccgatctcagcaatccggatctgctgccgttc
acccgcgccgtgatggacgagacggtgcggctgtatccgccggccttcctgatcgcgcgc
gcggccagcggccctgaccagatcgccgcattcgaggtcaagcgcggcgacgtggtcctg
atctcgccctggctcctgcaccggcacgagcggctgtggcggtcgcccaacgccttcatg
cccgagcgattcctgccgggcgcgccgccaccggagcggttcgcctatctgccgttcggc
gccggcgcccgcgtctgcatcggggctcatttcgcgctcgtcgaagcggtgctggcgctg
gcgcgcctggttgccgccttccggatcgagctggtcgatcccgcgccggtcatgccggtc
ggcgtggtgacgacgcagcccgaccgttcaccactgttcaggatcacgccgcgctga

DBGET integrated database retrieval system