KEGG   Bradyrhizobium sp. ORS 278: BRADO0400Help
Entry
BRADO0400         CDS       T00516                                 

Gene name
tesA
Definition
multifunctional acyl-CoA thioesterase I/protease I/lysophospholipasel(I) (EC:3.1.1.5 3.1.2.-)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
bra  Bradyrhizobium sp. ORS 278
Pathway
Biosynthesis of unsaturated fatty acids
Class
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:bra01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
406729..407361
Genome map
AA seq 210 aa AA seqDB search
MHILVLMLALMTAGPAFAGTEAGKPIKLVVLGDSLSAGLGLSASDSFPSKLQKALQAKGL
AIDLTNAGVSGDTSSGGRDRLDWSVADGTEAVIVELGANDALRGIDPSVTRQALTEIVKR
LKARGIAVMLCGMLAPPNYGSDYAVKFNAIYPDLAKEFDVPLYPFFLDGVAADPKLNQAD
GIHPTAAGVDIIVSRMLPTVEAFLRPLRGQ
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
gtgcacatactcgtgttgatgctcgccttgatgacagccggaccggcgttcgcgggcact
gaggccggcaagccgatcaagctggtggtgctcggcgattcgctgagcgccggcctcggc
ctgtccgcctccgactctttcccctccaaactgcaaaaggcgttgcaggccaaggggctg
gcgatcgacttgaccaatgccggggtgtccggagacacctcctccggcggccgcgaccgg
ctcgactggtcggtggccgacgggaccgaggctgtcatcgtcgagctcggcgccaatgat
gctctgcgcggcatcgatccgtccgtcacccggcaggccctgaccgagatcgtcaagcgg
ctgaaggcgcgtggcatcgccgtcatgctgtgcggcatgctcgcgccgccgaattacggc
agcgactacgctgttaagttcaatgcgatctaccctgacctcgccaaggagttcgacgtc
ccgctctacccgttcttcctcgacggcgttgctgccgaccccaagctcaaccaggcggac
ggcattcacccgaccgccgccggcgtcgatatcatcgtctcccgcatgctgcctacggtc
gaagcattcctgcgtccgcttcgtgggcaatga

DBGET integrated database retrieval system