KEGG   Bradyrhizobium sp. ORS 278: BRADO0407Help
Entry
BRADO0407         CDS       T00516                                 

Gene name
sucB
Definition
(GenBank) Dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase complex (E2); acid-inducible
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
bra  Bradyrhizobium sp. ORS 278
Pathway
bra00020  Citrate cycle (TCA cycle)
bra00310  Lysine degradation
bra01100  Metabolic pathways
bra01110  Biosynthesis of secondary metabolites
bra01120  Microbial metabolism in diverse environments
bra01130  Biosynthesis of antibiotics
bra01200  Carbon metabolism
Module
bra_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bra_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bra00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BRADO0407 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    BRADO0407 (sucB)
Enzymes [BR:bra01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     BRADO0407 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H
Motif
Other DBs
NCBI-ProteinID: CAL74355
RhizoBase: BRADO0407
UniProt: A4YKC9
Position
416144..417385
Genome map
AA seq 413 aa AA seqDB search
MTDIRVPTLGESVTEATIGRWFKKAGDAVAVDEPLVELETDKVTIEVPAPSAGTLGEIIA
KDGETVAVGALLGQINDGAAAAKPAAAAPAPAPAKPAAAAPAPAPAPAKALPADTPQAPS
VRKLSAESGVDATTVPGSGKDGRVTKGDMLAAIERAASAPTPVNQPAASVQVRAPSPADD
AAREERVKMTRLRQTIARRLKDVQNTAAMLTTFNEVDMTHVMALRSQYKDVFEKKHGSKL
GFMGFFTKAVVQALKDIPAVNAEIDGSDLIYKNYYHIGVAVGTDKGLVVPVVRDCDHKSI
ADIEKGIADFGRRARDGQLKIDEMQGGTFTITNGGIYGSLMSTPILNAPQSGILGMHKIQ
ERPMVVGGKIEVRPMMYLALSYDHRVIDGKEAVTFLVRVKESLEDPARLVLDL
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgactgacattcgcgttccgacgctcggtgaatccgtcaccgaagccaccatcggccgc
tggttcaagaaggcgggcgacgcggtcgccgtcgacgagccgctggtcgagctcgagacc
gacaaggtgaccatcgaggtgcccgccccgtcggccggcacgctcggcgagatcatcgcc
aaggacggtgagaccgtcgccgtcggcgcgctgctcggccagatcaatgacggcgcggcc
gctgccaagccggccgccgctgcgcccgcgccggctccggcaaagcccgccgcggcggct
ccggctcccgcgccggcgccggccaaggcgctgccggccgatacgccgcaggccccgtcg
gtgcgcaagctctcggccgagagcggtgtcgatgccaccacggtgccgggctccggcaag
gatggccgcgtcaccaagggcgacatgctggccgcgatcgagcgcgccgcgtcggcgccg
accccggtcaatcagcccgccgcatccgtgcaggtccgcgcgccgtcgcctgccgatgac
gccgcgcgcgaggagcgcgtcaagatgacccggctgcgccagaccatcgcgcgccgtctc
aaggacgtgcagaacaccgcggcgatgctgacgaccttcaacgaggtcgacatgacccac
gtgatggcgctgcgcagccagtacaaggacgtgttcgagaagaagcacggctccaagctc
ggcttcatgggcttcttcaccaaggccgtggtgcaggcgctgaaggacatcccggcggtc
aacgccgagatcgacggcagcgacctgatctacaagaactactatcatatcggcgtcgcc
gtcggcaccgacaagggcctggtcgtgccggtcgtgcgcgactgcgaccacaagtcgatc
gccgacatcgagaagggcatcgccgatttcggccgccgcgcccgtgacggccagctcaag
atcgacgagatgcagggcggcaccttcacgatcaccaatggcggcatctacggctcgctg
atgtcgacgccgatcctgaacgcgccgcagtccggcatcctcggcatgcacaagatccag
gagcgtccgatggtggtcggcggcaagatcgaggtgcgcccgatgatgtatctggcgctg
tcctatgatcaccgcgtcatcgacggcaaggaagccgtcaccttcctggtgcgcgtcaag
gaaagcctggaagatccggcgcggctcgtcctggatctctga

DBGET integrated database retrieval system