KEGG   Bradyrhizobium sp. ORS 278: BRADO0432Help
Entry
BRADO0432         CDS       T00516                                 

Gene name
obgE
Definition
(GenBank) GTP-binding protein with nucleoside triP hydrolase domain; DNA-binding GTPase involved in cell partioning; multicopy suppresssor of ftsJ(rrmJ)
  KO
K03979  
GTPase [EC:3.6.5.-]
Organism
bra  Bradyrhizobium sp. ORS 278
Brite
Enzymes [BR:bra01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.5  Acting on GTP to facilitate cellular and subcellular movement
    3.6.5.-  
     BRADO0432 (obgE)
Ribosome biogenesis [BR:bra03009]
 Prokaryotic Type
  GTPases
   BRADO0432 (obgE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
RhizoBase: 
UniProt: 
Position
complement(443284..444354)
Genome map
AA seq 356 aa AA seqDB search
MKFLDEAKVYVRSGDGGNGCVAFRREKFIEFGGPNGGNGGRGGDVVIEAVDGLNTLIDYR
YQQHFKAQKGENGMGKDRHGAGGKSIVLKVPVGTQIFDEDRETLIHDFTAVGERFVLAEG
GNGGFGNAHFKSPTNRAPRHANPGQPGEERWIWLRMKLIADAGLVGLPNAGKSTFLSKVS
AAKPKIADYPFTTLHPQLGVVNADGREFVLADIPGLIEGAHEGAGLGDRFLGHVERCRVL
LHLVDATCEHAGKAYKTVRHELEAYGGDLTDKIEIVALNKIDAVDPDELKKQRDRLKRAA
KKTPILISGATGEGVKEALRKLADVVGEQPVSSKAKNAVESAATEEPWAAPVPPQG
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgaaattcctcgatgaagccaaggtctatgtgcgctcgggcgacggcggcaacggttgc
gttgcgttccggcgcgagaagttcatcgagttcggcggcccgaacggcggcaatggcggc
cgcggcggcgacgtcgtgatcgaggccgtcgacggcctcaacaccctgatcgactaccgt
taccagcagcatttcaaggcccaaaagggcgagaacggcatgggcaaggaccgccacggc
gccggtggcaagtcgatcgtgctcaaggttcccgtcggcacccagatcttcgacgaggat
cgcgagacactgatccacgacttcaccgccgtcggcgagcgattcgtgctggccgagggc
ggcaatggcggcttcggcaacgcgcatttcaagtcgccgaccaaccgtgcgccgcggcat
gccaatcccggccagcccggcgaggagcgctggatctggctgcgcatgaagctgatcgcc
gatgccggcctcgtcggactgcccaatgccggcaaatcgacgttcttgtccaaggtgtcg
gcggccaagccgaagatcgccgactatccgttcaccaccctgcatccgcagctcggcgtg
gtgaatgccgacggccgcgaatttgtgctcgccgacattcccggcctgatcgagggcgcg
catgagggcgccggtctcggcgaccgcttcctcggccatgtcgagcgctgccgcgtgctg
ctgcacctggtcgatgccacctgcgagcatgccggcaaggcctacaagacggtgcggcac
gagctcgaggcctatggcggcgacctgaccgacaagatcgagatcgtcgcgctgaacaag
atcgacgcggttgatccggacgagctgaagaagcagcgggaccggctgaagcgcgccgcc
aagaagacgccgatactgatctccggtgcgaccggcgaaggcgtcaaggaggcgctgcgc
aagctcgccgacgtggtcggcgaacagccggtgtcgagcaaggcgaagaacgcagtcgag
agcgccgcaaccgaggagccgtgggcggctccggtcccgccgcaaggctga

DBGET integrated database retrieval system