KEGG   Bradyrhizobium sp. ORS 278: BRADO0591Help
Entry
BRADO0591         CDS       T00516                                 

Definition
(GenBank) putative Glycosyl hydrolase, family 3
  KO
K01207  beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
bra  Bradyrhizobium sp. ORS 278
Pathway
bra00520  Amino sugar and nucleotide sugar metabolism
bra01100  Metabolic pathways
bra01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:bra00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    BRADO0591
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    BRADO0591
Enzymes [BR:bra01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     BRADO0591
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3
Motif
Other DBs
NCBI-ProteinID: CAL74527
RhizoBase: BRADO0591
UniProt: A4YKV1
Position
complement(608833..609942)
Genome map
AA seq 369 aa AA seqDB search
MLSLRAGLAAECSNRAATSQLVGPMIMAGFFGTKPSDAGFQQLLADLEEGLIGGVVILGR
NVGTRDDLVGMIERIRACKCAVPPFIAIDDEGGTVERLGPSIGLAATPSAAEIARGSVAA
ARETYAALAAKLATLHINVNLAPVVDLNTNPANPIIGQRQRSYGSEPDTVVRYAAAFVQA
HRKQGILTVLKHFPGHGSSTADSHAGLADVTTTWSPAELKPYRQLMRNGLAGAIMVGHLA
NISRWGGVATQSEGHAIDRLLRRELGYDGVVMTDDLAMKAILDAKPPASAAGDAVKAGAD
IIMFTKLGEEDQTSDVGREINAALTAAVCSSEIKTGAVQRSVARIRKWMSGWKRPSHGQA
KRHATVVEH
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
gtgctgtcgctccgggccggccttgccgccgagtgcagcaacagggccgcgacctcgcaa
ctcgtcggcccgatgatcatggccgggttcttcggcaccaagccatccgatgccggattt
cagcagctcctggccgatctcgaagagggtctgatcggcggcgtcgtcatcctcggccgc
aatgtcggcacgcgggatgatctcgtgggaatgatcgagcggattcgagcctgcaaatgc
gcggtgcctccgttcatcgccatcgacgacgagggcggcacggtggagcggctcggcccc
agcatcggtttggccgcgacgccgtcggccgcggagatcgcccgcggctccgtggcggcc
gcgcgtgagacctacgccgcgctcgccgcgaagctcgcgacgctgcacatcaacgtcaac
ctcgcgccggtggtcgacctcaacaccaatcccgcgaacccgatcatcggccagcggcaa
cgcagctatggcagcgagcccgacaccgtcgtccgctatgccgcggccttcgtgcaggcg
caccgcaagcagggcatcctgaccgtgctcaagcattttccggggcatggctcgtcgacc
gccgacagccacgccggccttgccgacgtcaccaccacctggtcgcccgcagagttgaag
ccgtacaggcagctgatgcggaacgggctggctggagcgatcatggtcgggcacctcgcc
aatatcagccgctggggcggggtcgccacccaaagcgagggtcatgcgatcgaccgcctg
ctgcgccgcgagctcggctatgacggcgtggtcatgaccgacgacctcgccatgaaggcg
attctcgacgccaagccgccggcctccgccgcgggggacgccgtgaaagcgggcgccgac
atcatcatgttcacgaagctcggcgaggaggaccagacctccgacgtcggccgcgagatc
aacgctgcgctgacggctgccgtgtgctcgagcgagatcaagaccggcgcggtacaacgc
tcggtggcgcggattcgcaaatggatgtcgggttggaagcggcccagccacgggcaggca
aagcgccacgcgaccgttgttgagcattga

DBGET integrated database retrieval system