KEGG   Bradyrhizobium sp. ORS 278: BRADO0674Help
Entry
BRADO0674         CDS       T00516                                 

Definition
di-heme cytochrome c peroxidase (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
bra  Bradyrhizobium sp. ORS 278
Brite
Enzymes [BR:bra01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     BRADO0674
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
706781..707857
Genome map
AA seq 358 aa AA seqDB search
MMPRSFTARSLSLGTAVALVFGFATAGLGAALVGETKQVTLQQKGPSSTDALKALYRRPA
TIPFPKDNPYTPEKAALGKKLYFDTRLSVSMAQSCGSCHSPSFGWGDGLAVGVGNGMNKL
GRHSPTVVNAAWGEIFMWDGRLANLEEQALGPIQAAGEMNMPLDHLMQRLGSIPEYKPLF
EAAFPKDGMTPKTLAKAIATYERTVVSDRAPFDAWIDGDERAISEDAKRGFALFNGKAQC
VTCHEGWNFTNDGFQDIGLPSKDIGRGEYAPGVIKMQHAFKTPGLREITRRAPFMHDGSL
ATLEQVVDHYDSGGVDRPSRSDLMRPLGLSAAEKSDLVAFLKTLTSNLTPTAAPVLPR
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgatgccgcgcagcttcaccgctcgttccctttcgctcggcaccgctgttgccctcgtc
ttcggcttcgccaccgccggcctcggcgccgctctcgtcggcgagaccaagcaggtcacg
ctgcagcagaaaggtccgtcgagcacggatgcgttgaaggcgttgtaccggcgtccggcg
acgatcccgttccctaaggacaatccctacacgcccgaaaaggcggcgctcggcaagaag
ctgtatttcgacacgcgactgtcggtgtcgatggcgcagtcctgcggcagctgccacagc
ccgagcttcggctggggcgatggactcgctgtcggcgtcggcaatggcatgaacaagctc
ggccggcactcgccgactgtcgtcaacgcggcctggggcgagatcttcatgtgggacggc
cggctggccaatctggaggagcaggcgctcggtccgatccaggctgccggcgagatgaac
atgccgctcgatcatctgatgcagcgtctcggttcgatcccggaatacaagccgctgttc
gaagccgcttttcccaaggacggcatgacgccgaagacgctcgccaaggcgatcgcgacc
tacgagcgcaccgtagtctcggaccgcgcgcccttcgatgcctggatcgatggcgacgag
agggcgatctccgaggacgccaagcgcggctttgcgctgttcaacggcaaggcgcagtgc
gtgacgtgccacgaaggctggaacttcaccaatgacggcttccaggacatcgggctgccg
agcaaggatatcggccggggcgagtacgcgcccggcgtcatcaagatgcagcatgccttc
aagacaccgggcctgcgcgagatcacgcgccgcgcgccgttcatgcatgacggctcgctg
gccacgctggagcaggtcgtcgaccactatgacagcggcggcgtcgatcggccgagccgt
tccgacctgatgcgcccgctcgggctgagcgctgccgaaaagtccgatctcgttgcgttc
ctgaaaactctcaccagcaatctcactccgacggccgccccggtgctgccgcgctaa

  All links  
No link information was found.   
DBGET integrated database retrieval system