KEGG   Bradyrhizobium sp. ORS 278: BRADO0757Help
Entry
BRADO0757         CDS       T00516                                 

Definition
phosphomannomutase/phosphoglucomutase (PMM / PGM) (EC:5.4.2.2 5.4.2.8)
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
bra  Bradyrhizobium sp. ORS 278
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bra00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BRADO0757
   00030 Pentose phosphate pathway
    BRADO0757
   00051 Fructose and mannose metabolism
    BRADO0757
   00052 Galactose metabolism
    BRADO0757
   00500 Starch and sucrose metabolism
    BRADO0757
   00520 Amino sugar and nucleotide sugar metabolism
    BRADO0757
  Nucleotide metabolism
   00230 Purine metabolism
    BRADO0757
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BRADO0757
Enzymes [BR:bra01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     BRADO0757
    5.4.2.8  phosphomannomutase
     BRADO0757
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
802600..804099
Genome map
AA seq 499 aa AA seqDB search
MFPKPKPILVPNTYAFESEPMVKPTGFREYDARWLFNKEINLMGVQALGMGLGALIAERG
VSREIVTGHDFRGYSASIKYALISGLMAAGCKVHDIGLAVTPMAYFAQFELDVPCVAMVT
ASHNDNGWTGVKMGANRPLTFGPEEMTRLKEIVLNAEFKNTGGGSYQFHENFPARYIADL
TNRPKLKRKLKVVAACGNGTAGAFAPQVLEAIGCEVIPLDTELDHTFPKYNPNPEDMEML
HAIRDAVLAHKADVGLGFDGDGDRCGVVDNTGEEIFADKVGVMLARDMSAIHKDAQFVVD
VKSTGLFMTDPVLQAQGAKTEYWKTGHSYMKRRTNELGALAGFEKSGHFFFNKPFGRGYD
DGLVSAIAICEMLDRAPGKSMADLKEALPKTWSSPTMSPHCGDEVKYGVVDAVVKHFQTL
QQQGGKVAGQSIRDLVTVNGVRVTVEDGSWGLVRASSNKPELVVVVESPVSEQRMHDMFE
AVNVVLRTHPEVGAYNQTI
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgttccccaagccgaaacccatcttggtccccaatacctacgcctttgaatccgagccg
atggtgaagccgacgggcttccgcgaatatgacgcgcgctggctgttcaacaaggaaatc
aacctgatgggggtgcaggcgctcggcatggggctgggcgcgctgatcgcggagcgcggc
gtgagccgagaaatcgtgaccggtcacgatttccgtggctactccgcctcgatcaaatac
gcgctgatctcgggcctgatggccgccggctgcaaggtgcacgacatcggtcttgcggtg
acacccatggcctatttcgcgcagttcgagctcgatgtgccctgcgtcgcgatggtgacc
gcctcgcataatgacaacggctggaccggcgttaagatgggcgccaatcgtccgctgacc
tttgggccggaggaaatgacacggttgaaagagatcgtgctcaacgccgagttcaagaac
acgggcggcggctcgtatcagttccacgagaatttcccggcgcgctacatcgccgatctg
actaaccgtccgaaactgaagcgcaagctcaaggtcgtcgccgcctgcggcaacggcacc
gcgggcgcgttcgcgccacaggtgctggaggcgattggctgcgaggtgatcccgctcgac
accgagctcgatcacaccttcccgaaatacaatcccaatcccgaagacatggagatgctg
cacgccattcgcgacgccgtactcgcccacaaggccgatgtcggcctcggcttcgacggc
gacggcgaccgctgtggcgtggtcgacaacaccggcgaggagatcttcgccgacaaggtc
ggcgtcatgctggcgcgcgacatgtccgcgatccacaaggacgcgcagttcgtcgtcgac
gtgaaatcaaccggcctgttcatgaccgatccggtgctgcaggcgcagggcgccaagacc
gaatattggaagaccggccattcctacatgaagcgccggaccaacgagctcggtgcgctc
gcgggcttcgagaagtccggccatttcttcttcaacaagccgttcggtcgcggctatgat
gacggcctcgtctcggcgatcgcgatctgcgagatgctcgaccgcgcgccgggcaagtcg
atggccgacctcaaggaggccctgcccaagacgtggtcgtcgccgacgatgtcgccgcat
tgcggcgacgaggtcaaatacggcgtcgtcgacgcggtggtgaagcatttccagacgctg
cagcagcagggcggcaaggtcgccggtcaatcgatccgcgatctcgtcaccgtcaacggc
gtgcgtgtcacggtggaggacggcagctggggcctggtgcgcgcgtcatccaacaagccg
gagctcgtcgtcgtcgtcgaaagccccgtgtcggagcagcgcatgcacgacatgttcgag
gcggtcaacgtcgtgctgcggacgcaccccgaagtgggcgcctataatcagacgatctga

DBGET integrated database retrieval system